Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T64765
|
||||
| Former ID |
TTDC00079
|
||||
| Target Name |
Histamine H3 receptor
|
||||
| Gene Name |
HRH3
|
||||
| Synonyms |
G protein-coupled receptor 97; HH3R; Histamine receptor 3; HRH3
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
| Attention deficit hyperactivity disorder [ICD9: 314; ICD10: F90] | |||||
| Alcohol use disorders [ICD9: 303; ICD10: F10.2] | |||||
| Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42] | |||||
| Alzheimer disease; Schizophrenia [ICD9:331, 295; ICD10: G30, F20] | |||||
| Allergic rhinitis [ICD9: 472.0, 477, 995.3; ICD10: J00, J30, J31.0, T78.4] | |||||
| Cognitive disorders [ICD9: 290-294, 294.0, 780.09, 780.9, 780.93; ICD10: F01-F07, F04, F05, R41.3] | |||||
| Central nervous system disease [ICD10: G00-G99] | |||||
| Dementia; Obesity [ICD9:290-294, 278; ICD10: F01-F07, E66] | |||||
| Diabetic neuropathy; Musculoskeletal pain [ICD9:250, 250.6, 356.0, 356.8, 338, 780; ICD10: E11.40, R52, G89] | |||||
| Dementia [ICD9: 290-294; ICD10: F01-F07] | |||||
| Eating disorder; Epilepsy; Pain [ICD9: 307.5, 338,780; ICD10: F50, R52, G89] | |||||
| Excessive daytime sleepiness [ICD9: 291.82, 292.85, 307.43-307.44, 327.1, 780.53-780.54; ICD10: F51.1, G47.1] | |||||
| Mild to moderate alzheimer disease; Dementia [ICD9: 290-294, 331.0; ICD10: F01-F07, G30] | |||||
| Metabolic disorders [ICD9: 270-279; ICD10: E70-E89] | |||||
| Narcolepsy [ICD9: 347; ICD10: G47.4] | |||||
| Neurological disease [ICD9: 338, 338.2, 410, 782.3,780; ICD10: I21, I22, R52, R52.1-R52.2, R60.9, G89] | |||||
| Obese insulin-resistant disorders [ICD9: 250; ICD10: E11] | |||||
| Obesity [ICD9: 278; ICD10: E66] | |||||
| Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
| Schizophrenia [ICD9: 295; ICD10: F20] | |||||
| Sleep disorders [ICD9: 307.4, 327, 780.5; ICD10: F51, G47] | |||||
| Function |
The H3 subclass of histamine receptors could mediate the histamine signals in CNS and peripheral nervous system. Signals through the inhibition of adenylate cyclase and displays high constitutive activity (spontaneous activity in the absence of agonist). Agonist stimulation of isoform 3 neither modified adenylate cyclase activity nor induced intracellular calcium mobilization.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T64765
|
||||
| UniProt ID | |||||
| Sequence |
MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR RAFTKLLCPQKLKIQPHSSLEHCWK |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Pitolisant | Drug Info | Phase 3 | Schizophrenia | [524221] |
| ABT-288 | Drug Info | Phase 2 | Alzheimer disease; Schizophrenia | [522864], [541972] | |
| ABT-652 | Drug Info | Phase 2 | Diabetic neuropathy; Musculoskeletal pain | [523180] | |
| AZD-5213 | Drug Info | Phase 2 | Alzheimer disease | [523825] | |
| Bavisant | Drug Info | Phase 2 | Attention deficit hyperactivity disorder | [522173] | |
| GSK239512 | Drug Info | Phase 2 | Mild to moderate alzheimer disease; Dementia | [524191] | |
| JNJ-17216498 | Drug Info | Phase 2 | Narcolepsy | [521955] | |
| JNJ-39220675 | Drug Info | Phase 2 | Alcohol use disorders | [522512] | |
| S-38093 | Drug Info | Phase 2 | Alzheimer disease | [549097] | |
| SAR-110894 | Drug Info | Phase 2 | Alzheimer disease | [523311] | |
| ABT-239 | Drug Info | Phase 1 | Cognitive disorders | [536039], [538729] | |
| APD-916 | Drug Info | Phase 1 | Sleep disorders | [522988] | |
| HPP404 | Drug Info | Phase 1 | Allergic rhinitis | [551746] | |
| Irdabisant | Drug Info | Phase 1 | Cognitive disorders | [524373] | |
| MK-3134 | Drug Info | Phase 1 | Dementia | [522645] | |
| MK-7288 | Drug Info | Phase 1 | Excessive daytime sleepiness | [522986] | |
| MK-0249 | Drug Info | Clinical trial | Obese insulin-resistant disorders | [532558] | |
| BP-2.94 | Drug Info | Discontinued in Phase 2 | Pain | [546450] | |
| Cipralisant | Drug Info | Discontinued in Phase 2 | Attention deficit hyperactivity disorder | [536225], [538758] | |
| GSK835726 | Drug Info | Discontinued in Phase 2 | Allergic rhinitis | [548731] | |
| GSK1004723 | Drug Info | Discontinued in Phase 1 | Allergic rhinitis | [548732] | |
| SAR-152954 | Drug Info | Discontinued in Phase 1 | Sleep disorders | [549206] | |
| GR-175737 | Drug Info | Terminated | Discovery agent | [538757], [546329] | |
| GT-2016 | Drug Info | Terminated | Alzheimer disease | [545044] | |
| GT-2203 | Drug Info | Terminated | Anxiety disorder | [546559] | |
| Thioperamide | Drug Info | Terminated | Cognitive disorders | [538782], [545719] | |
| UCL-1390 | Drug Info | Terminated | Eating disorder; Epilepsy; Pain | [545875] | |
| Inhibitor | (1H-indol-2-yl)(piperazin-1-yl)methanone | Drug Info | [527934] | ||
| (1R,2R)-2-(1H-Imidazol-4-yl)-1-methyl-propylamine | Drug Info | [533720] | |||
| (1R,2S)-2-(1H-Imidazol-4-yl)-1-methyl-propylamine | Drug Info | [533720] | |||
| (1S,2S)-2-(1H-Imidazol-4-yl)-cyclopentylamine | Drug Info | [533720] | |||
| (R)-1-(2-methoxyphenethyl)-2-methylpyrrolidine | Drug Info | [529212] | |||
| (R)-1-(3-methoxyphenethyl)-2-methylpyrrolidine | Drug Info | [529212] | |||
| (R)-1-(4-methoxyphenethyl)-2-methylpyrrolidine | Drug Info | [529212] | |||
| (R)-1-(4-nitrophenethyl)-2-methylpyrrolidine | Drug Info | [529212] | |||
| (R)-2-(2-(2-methylpyrrolidin-1-yl)ethyl)phenol | Drug Info | [529212] | |||
| (R)-2-(2-(2-methylpyrrolidin-1-yl)ethyl)pyridine | Drug Info | [529212] | |||
| (R)-2-methyl-1-(2-m-tolyl-ethyl)-pyrrolidine | Drug Info | [529212] | |||
| (R)-2-methyl-1-(2-p-tolyl-ethyl)-pyrrolidine | Drug Info | [529212] | |||
| (R)-3-(1H-imidazol-4-yl)propyl sec-butylcarbamate | Drug Info | [530465] | |||
| (R)-3-(2-(2-methylpyrrolidin-1-yl)ethyl)pyridine | Drug Info | [529212] | |||
| (R)-4-(2-(2-methylpyrrolidin-1-yl)ethyl)pyridine | Drug Info | [529212] | |||
| (R)-6-(2-(2-methylpyrrolidin-1-yl)ethyl)quinoline | Drug Info | [530904] | |||
| (S)-1-(2-methoxyphenethyl)-2-methylpyrrolidine | Drug Info | [529212] | |||
| (S)-1-(3-methoxyphenethyl)-2-methylpyrrolidine | Drug Info | [529212] | |||
| (S)-1-(4-methoxyphenethyl)-2-methylpyrrolidine | Drug Info | [529212] | |||
| (S)-1-(4-nitrophenethyl)-2-methylpyrrolidine | Drug Info | [529212] | |||
| (S)-2-(2-(2-methylpyrrolidin-1-yl)ethyl)phenol | Drug Info | [529212] | |||
| (S)-2-(2-(2-methylpyrrolidin-1-yl)ethyl)pyridine | Drug Info | [529212] | |||
| (S)-2-methyl-1-(2-m-tolyl-ethyl)-pyrrolidine | Drug Info | [529212] | |||
| (S)-2-methyl-1-(2-p-tolyl-ethyl)-pyrrolidine | Drug Info | [529212] | |||
| (S)-3-(1H-imidazol-4-yl)propyl sec-butylcarbamate | Drug Info | [530465] | |||
| (S)-4-(2-(2-methylpyrrolidin-1-yl)ethyl)pyridine | Drug Info | [529212] | |||
| 1-(2-(naphthalen-2-yl)ethyl)pyrrolidine | Drug Info | [529212] | |||
| 1-(2-m-tolyl-ethyl)-pyrrolidine | Drug Info | [529212] | |||
| 1-(2-methoxyphenethyl)pyrrolidine | Drug Info | [529212] | |||
| 1-(2-p-tolyl-ethyl)-pyrrolidine | Drug Info | [529212] | |||
| 1-(3-(2-(3-methoxyphenoxy)ethoxy)propyl)azepane | Drug Info | [530044] | |||
| 1-(3-(3-phenylpropoxy)propyl)piperidine | Drug Info | [529673] | |||
| 1-(3-(4-(2-fluoroethyl)phenoxy)propyl)piperidine | Drug Info | [530019] | |||
| 1-(3-(4-(fluoromethyl)phenoxy)propyl)piperidine | Drug Info | [530019] | |||
| 1-(3-methoxyphenethyl)pyrrolidine | Drug Info | [529212] | |||
| 1-(4-(benzyloxy)phenethyl)pyrrolidine | Drug Info | [529212] | |||
| 1-(4-methoxyphenethyl)pyrrolidine | Drug Info | [529212] | |||
| 1-(4-nitrophenethyl)pyrrolidine | Drug Info | [529212] | |||
| 1-[2-(2,4,6-trimethyl-phenyl)-ethyl]-pyrrolidine | Drug Info | [529212] | |||
| 2-((1H-imidazol-4-yl)methyl)pyridine | Drug Info | [531088] | |||
| 2-((2-ethoxyphenoxy)methyl)-4-isopropylmorpholine | Drug Info | [529751] | |||
| 2-(1,4'-bipiperidin-1'-yl)thiazolo[4,5-b]pyridine | Drug Info | [530397] | |||
| 2-(1,4'-bipiperidin-1'-yl)thiazolo[4,5-c]pyridine | Drug Info | [530397] | |||
| 2-(1H-Imidazol-4-yl)-cyclopropylamine | Drug Info | [526614] | |||
| 2-(2-(4-tert-Butylphenylthio)ethyl)-1H-imidazole | Drug Info | [531088] | |||
| 2-(2-(pyrrolidin-1-yl)ethyl)-1H-indole | Drug Info | [529212] | |||
| 2-(2-(pyrrolidin-1-yl)ethyl)phenol | Drug Info | [529212] | |||
| 2-(2-(pyrrolidin-1-yl)ethyl)pyridine | Drug Info | [529212] | |||
| 2-(3-Methyl-3H-imidazol-4-yl)-ethylamine | Drug Info | [534790] | |||
| 2-(4-Cyclopentyl-piperazin-1-yl)-quinoline | Drug Info | [527370] | |||
| 2-(4-Cyclopropyl-piperazin-1-yl)-quinoline | Drug Info | [527370] | |||
| 2-(4-Isopropyl-piperazin-1-yl)-quinoline | Drug Info | [527370] | |||
| 2-(4-Methyl-piperazin-1-yl)-quinoline | Drug Info | [527370] | |||
| 2-(4-Propyl-piperazin-1-yl)-quinoline | Drug Info | [527370] | |||
| 2-(ethoxycarbonyl)-1H-indole-5-carboxylic acid | Drug Info | [530151] | |||
| 2-[2-(1H-Imidazol-4-yl)-cyclopropyl]-ethylamine | Drug Info | [526614] | |||
| 2-[4-(1-Ethyl-propyl)-piperazin-1-yl]-quinoline | Drug Info | [527370] | |||
| 3-((1H-imidazol-4-yl)methyl)pyridine | Drug Info | [531088] | |||
| 4-((1H-imidazol-4-yl)methyl)-1-heptylpiperidine | Drug Info | [527818] | |||
| 4-((1H-Imidazol-4-yl)methyl)-1-phenylpiperidine | Drug Info | [551227] | |||
| 4-((2R,3S)-2-Methyl-pyrrolidin-3-yl)-1H-imidazole | Drug Info | [533720] | |||
| 4-((2S,3R)-2-Methyl-pyrrolidin-3-yl)-1H-imidazole | Drug Info | [533720] | |||
| 4-(2-(3,4-Dimethylphenylamino)ethyl)-1H-imidazole | Drug Info | [530846] | |||
| 4-(2-(3-tert-Butylphenylamino)ethyl)-1H-imidazole | Drug Info | [530846] | |||
| 4-(2-(4-Cyclohexylphenylamino)ethyl)-1H-imidazole | Drug Info | [530846] | |||
| 4-(2-(4-Methoxyphenylamino)ethyl)-1H-imidazole | Drug Info | [530846] | |||
| 4-(2-(4-Methylphenylamino)ethyl)-1H-imidazole | Drug Info | [530846] | |||
| 4-(2-(4-tert-Butylphenylamino)ethyl)-1H-imidazole | Drug Info | [530846] | |||
| 4-(2-(Cyclohexylamino)ethyl)-1H-imidazole | Drug Info | [530846] | |||
| 4-(2-(Phenylamino)ethyl)-1H-imidazole | Drug Info | [530846] | |||
| 4-(2-(pyrrolidin-1-yl)ethyl)pyridine | Drug Info | [529212] | |||
| 4-(3-Phenoxy-propyl)-1H-imidazole | Drug Info | [526023] | |||
| 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [531079] | |||
| 4-(4-Phenyl-butyl)-1H-imidazole | Drug Info | [526023] | |||
| 4-(6-Cyclohexyl-hex-3-ynyl)-1H-imidazole | Drug Info | [534790] | |||
| 4-(6-Cyclopentyl-hex-3-ynyl)-1H-imidazole | Drug Info | [534790] | |||
| 4-(7,7-Dimethyl-oct-3-ynyl)-1H-imidazole | Drug Info | [534790] | |||
| 4-(7-Methyl-oct-3-ynyl)-1H-imidazole | Drug Info | [534790] | |||
| 4-(8-Phenyl-oct-3-ynyl)-1H-imidazole | Drug Info | [534790] | |||
| 4-Benzyl-1-[3-phenylpropoxy)propyl]piperidine | Drug Info | [529673] | |||
| 4-Butyl-1-[3-(phenylpropoxy)propyl]piperidine | Drug Info | [529673] | |||
| 4-Hept-3-ynyl-1H-imidazole | Drug Info | [534790] | |||
| 4-Hex-3-ynyl-1H-imidazole | Drug Info | [534790] | |||
| 4-isopropyl-2-(phenoxymethyl)morpholine | Drug Info | [529751] | |||
| 4-Propyl-1-[3-(phenylpropoxy)propyl]piperidine | Drug Info | [529673] | |||
| 4-[3-(4-Butyl-phenoxy)-propyl]-1H-imidazole | Drug Info | [525896] | |||
| 4-[3-(4-Ethynyl-phenoxy)-propyl]-1H-imidazole | Drug Info | [525896] | |||
| 4-[3-(4-Methoxy-phenoxy)-propyl]-1H-imidazole | Drug Info | [526023] | |||
| 5-(2-(pyrrolidin-1-yl)ethyl)isothiazole | Drug Info | [529212] | |||
| 5-ethyl-2-(2-(pyrrolidin-1-yl)ethyl)pyridine | Drug Info | [529212] | |||
| 5-methoxy-2-(2-(pyrrolidin-1-yl)ethyl)-1H-indole | Drug Info | [529212] | |||
| 5-phenyl-2-(4-(piperidin-1-yl)butyl)oxazole | Drug Info | [531116] | |||
| Aerophobin-1 | Drug Info | [551359] | |||
| APLYSAMINE | Drug Info | [529632] | |||
| C-[2-(1H-Imidazol-4-yl)-cyclopropyl]-methylamine | Drug Info | [526614] | |||
| CARCININE | Drug Info | [529632] | |||
| CONESSINE | Drug Info | [530254] | |||
| Des-bromoaplysamine-1 | Drug Info | [527879] | |||
| GR-175737 | Drug Info | [534790] | |||
| GT-2016 | Drug Info | [534790] | |||
| IODOPROXYFAN | Drug Info | [526023] | |||
| JNJ-28583867 | Drug Info | [529199] | |||
| N-benzyl-4-cyclopentylpiperazine-1-carboxamide | Drug Info | [528367] | |||
| N-methyl-2-(pyridin-2-yl)ethanamine | Drug Info | [530151] | |||
| ST-1025 | Drug Info | [531116] | |||
| ST-1093 | Drug Info | [531116] | |||
| UCL-2138 | Drug Info | [530019] | |||
| VERONGAMINE | Drug Info | [551359] | |||
| VUF-10214 | Drug Info | [529387] | |||
| VUF-5296 | Drug Info | [526614] | |||
| VUF-5297 | Drug Info | [526614] | |||
| Agonist | (R)-alpha-methylhistamine | Drug Info | [535262], [536039] | ||
| (S)-alpha-methylhistamine | Drug Info | [526445] | |||
| GT-2203 | Drug Info | [543673] | |||
| H3 receptor inverse agonists | Drug Info | [543673] | |||
| imbutamine | Drug Info | [526894] | |||
| Imetit | Drug Info | [536039] | |||
| Immepip | Drug Info | [536039] | |||
| Immethridine | Drug Info | [536039] | |||
| impentamine | Drug Info | [526894] | |||
| impromidine | Drug Info | [535111] | |||
| Methimepip | Drug Info | [536039] | |||
| MK-0249 | Drug Info | [529576] | |||
| MK-3134 | Drug Info | [531503] | |||
| MK-7288 | Drug Info | [532509] | |||
| N-methylhistamine | Drug Info | [535111] | |||
| N-[3H]alpha-methylhistamine | Drug Info | [526605] | |||
| N-[3H]methylhistamine | Drug Info | [535111] | |||
| Pitolisant | Drug Info | [532787] | |||
| VUF 5207 | Drug Info | [526200] | |||
| VUF 8328 | Drug Info | [526200] | |||
| [3H](R)-alpha-methylhistamine | Drug Info | [535111] | |||
| Antagonist | A-304121 | Drug Info | [527161] | ||
| A-317920 | Drug Info | [536039] | |||
| A-331440 | Drug Info | [536039] | |||
| ABT-239 | Drug Info | [536039], [536761], [537279] | |||
| APD-916 | Drug Info | [531737] | |||
| ATH-90879 | Drug Info | [543673] | |||
| AZD-5213 | Drug Info | [531888] | |||
| Bavisant | Drug Info | [531879] | |||
| burimamide | Drug Info | [535111] | |||
| Ciproxifan | Drug Info | [536039] | |||
| Clobenpropit | Drug Info | [534934], [536039] | |||
| EVT-501 | Drug Info | [543673] | |||
| FUB 349 | Drug Info | [525918] | |||
| FUB-130 | Drug Info | [543673] | |||
| GSK-334429 | Drug Info | [543673] | |||
| GSK1004723 | Drug Info | [550963] | |||
| GSK189254A | Drug Info | [536039] | |||
| GSK239512 | Drug Info | [550963] | |||
| GSK835726 | Drug Info | [550963] | |||
| GT2394 | Drug Info | [526445] | |||
| HPP404 | Drug Info | [551746] | |||
| Irdabisant | Drug Info | [531661] | |||
| JB 98064 | Drug Info | [526445] | |||
| JNJ-17216498 | Drug Info | [527237] | |||
| JNJ-39220675 | Drug Info | [531268] | |||
| JNJ-5207852 | Drug Info | [536039] | |||
| PF-3900422 | Drug Info | [543673] | |||
| Proxyfan | Drug Info | [536039] | |||
| S-38093 | Drug Info | [549954] | |||
| SAR-110894 | Drug Info | [531888] | |||
| SAR-152954 | Drug Info | [551862] | |||
| SCH79687 | Drug Info | [536039] | |||
| SUVN-G1031 | Drug Info | [543673] | |||
| Thioperamide | Drug Info | [534934], [536039] | |||
| UCB-2892 | Drug Info | [543673] | |||
| UCL-1390 | Drug Info | [536225] | |||
| UCL1972 | Drug Info | [536039] | |||
| VUF 4904 | Drug Info | [526200] | |||
| VUF 5681 | Drug Info | [536039] | |||
| VUF5391 | Drug Info | [536039] | |||
| [123I]iodoproxyfan | Drug Info | [525918] | |||
| [125I]iodophenpropit | Drug Info | [533760] | |||
| Modulator | ABT-288 | Drug Info | |||
| ABT-652 | Drug Info | [549101] | |||
| BP-2.94 | Drug Info | [534203] | |||
| Binder | Cipralisant | Drug Info | [536066] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| References | |||||
| Ref 521955 | ClinicalTrials.gov (NCT00424931) A Safety and Effectiveness Study of a Single Dose of JNJ-17216498 in Patients With Narcolepsy. U.S. National Institutes of Health. | ||||
| Ref 522173 | ClinicalTrials.gov (NCT00566449) A Safety and Effectiveness Study of JNJ-31001074 in Adults With Attention-Deficit/Hyperactivity Disorder.. U.S. National Institutes of Health. | ||||
| Ref 522512 | ClinicalTrials.gov (NCT00804687) An Efficacy Study of JNJ-39220675 and Pseudoephedrine in Participants With Allergic Rhinitis. U.S. National Institutes of Health. | ||||
| Ref 522645 | ClinicalTrials.gov (NCT00887601) BOLD Functional Magnetic Resonance Imaging (fMRI) and Cerebral Blood Flow Measurements as Biomarkers for Cognition Enhancing Drugs (3134-006). U.S. National Institutes of Health. | ||||
| Ref 522864 | ClinicalTrials.gov (NCT01018875) Efficacy and Safety Study of ABT-288 in Subjects With Mild-to-Moderate Alzheimer's Disease. U.S. National Institutes of Health. | ||||
| Ref 522986 | ClinicalTrials.gov (NCT01092780) Pharmacodynamics and Efficacy of MK7288 (MK-7288-010). U.S. National Institutes of Health. | ||||
| Ref 522988 | ClinicalTrials.gov (NCT01093508) Single-dose Safety Study of APD916 in Healthy Volunteers. U.S. National Institutes of Health. | ||||
| Ref 523180 | ClinicalTrials.gov (NCT01207115) A Study of ABT-652 in Adults With Osteoarthritis Pain of the Knee. U.S. National Institutes of Health. | ||||
| Ref 523311 | ClinicalTrials.gov (NCT01266525) Effect of Different Doses of SAR110894D on Cognition in Patients With Mild to Moderate Alzheimer's Disease on Donepezil. U.S. National Institutes of Health. | ||||
| Ref 523825 | ClinicalTrials.gov (NCT01548287) A Study of the Safety and Tolerability of AZD5213 Effect on Sleep for Patients With Alzheimer's/Cognitive Impairment. U.S. National Institutes of Health. | ||||
| Ref 524191 | ClinicalTrials.gov (NCT01772199) Study to Assess Whether GSK239512 Can Remyelinate Lesions in Subjects With Relapsing Remitting Multiple Sclerosis. U.S. National Institutes of Health. | ||||
| Ref 524221 | ClinicalTrials.gov (NCT01800045) Pitolisant to Assess Weekly Frequency of Cataplexy Attacks and EDS in Narcoleptic Patients (HARMONY CTP). U.S. National Institutes of Health. | ||||
| Ref 524373 | ClinicalTrials.gov (NCT01903824) Pharmacokinetics and Pharmacodynamics (PK/PD) of CEP-26401 in Healthy Subjects. U.S. National Institutes of Health. | ||||
| Ref 532558 | (11)C-MK-8278 PET as a tool for pharmacodynamic brain occupancy of histamine 3 receptor inverse agonists. J Nucl Med. 2014 Jan;55(1):65-72. | ||||
| Ref 536039 | The histamine H3 receptor: from gene cloning to H3 receptor drugs. Nat Rev Drug Discov. 2005 Feb;4(2):107-20. | ||||
| Ref 536225 | Emerging drugs for eating disorder treatment. Expert Opin Emerg Drugs. 2006 May;11(2):315-36. | ||||
| Ref 538729 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1218). | ||||
| Ref 538757 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1243). | ||||
| Ref 538758 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1244). | ||||
| Ref 538782 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1267). | ||||
| Ref 541972 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6927). | ||||
| Ref 545044 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001957) | ||||
| Ref 545719 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004362) | ||||
| Ref 545875 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005172) | ||||
| Ref 546329 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007507) | ||||
| Ref 546450 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008192) | ||||
| Ref 546559 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008938) | ||||
| Ref 548731 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028154) | ||||
| Ref 548732 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028155) | ||||
| Ref 549097 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032202) | ||||
| Ref 525896 | Bioorg Med Chem Lett. 2000 Oct 16;10(20):2379-82.Analogues and derivatives of ciproxifan, a novel prototype for generating potent histamine H3-receptor antagonists. | ||||
| Ref 525918 | Distinct pharmacology of rat and human histamine H(3) receptors: role of two amino acids in the third transmembrane domain. Br J Pharmacol. 2000 Dec;131(7):1247-50. | ||||
| Ref 526023 | Bioorg Med Chem Lett. 2001 Apr 9;11(7):951-4.Different antagonist binding properties of human and rat histamine H3 receptors. | ||||
| Ref 526200 | Constitutive activity of histamine h(3) receptors stably expressed in SK-N-MC cells: display of agonism and inverse agonism by H(3) antagonists. J Pharmacol Exp Ther. 2001 Dec;299(3):908-14. | ||||
| Ref 526445 | Characteristics of recombinantly expressed rat and human histamine H3 receptors. Eur J Pharmacol. 2002 Oct 18;453(1):33-41. | ||||
| Ref 526605 | Molecular and pharmacological characterization of the mouse histamine H3 receptor. Eur J Pharmacol. 2003 Apr 25;467(1-3):57-65. | ||||
| Ref 526614 | J Med Chem. 2003 May 8;46(10):1980-8.Cyclopropane-based conformational restriction of histamine. (1S,2S)-2-(2-aminoethyl)-1-(1H-imidazol-4-yl)cyclopropane, a highly selective agonist for the histamine H3 receptor, having a cis-cyclopropane structure. | ||||
| Ref 526894 | Synthesis and structure-activity relationships of conformationally constrained histamine H(3) receptor agonists. J Med Chem. 2003 Dec 4;46(25):5445-57. | ||||
| Ref 527161 | Pharmacological and behavioral properties of A-349821, a selective and potent human histamine H3 receptor antagonist. Biochem Pharmacol. 2004 Sep 1;68(5):933-45. | ||||
| Ref 527237 | Acute wake-promoting actions of JNJ-5207852, a novel, diamine-based H3 antagonist. Br J Pharmacol. 2004 Nov;143(5):649-61. Epub 2004 Oct 4. | ||||
| Ref 527370 | J Med Chem. 2005 Jan 13;48(1):306-11.2-(4-alkylpiperazin-1-yl)quinolines as a new class of imidazole-free histamine H3 receptor antagonists. | ||||
| Ref 527818 | Bioorg Med Chem Lett. 2006 Jan 15;16(2):395-9. Epub 2005 Oct 21.Novel histamine H3 receptor antagonists based on the 4-[(1H-imidazol-4-yl)methyl]piperidine scaffold. | ||||
| Ref 527879 | Bioorg Med Chem Lett. 2006 Feb 15;16(4):897-900. Epub 2005 Nov 21.Aplysamine-1 and related analogs as histamine H3 receptor antagonists. | ||||
| Ref 527934 | J Med Chem. 2005 Dec 29;48(26):8289-98.Preparation and biological evaluation of indole, benzimidazole, and thienopyrrole piperazine carboxamides: potent human histamine h(4) antagonists. | ||||
| Ref 528367 | Bioorg Med Chem Lett. 2006 Oct 15;16(20):5303-8.Ureas with histamine H3-antagonist receptor activity--a new scaffold discovered by lead-hopping from cinnamic acid amides. | ||||
| Ref 529199 | Bioorg Med Chem Lett. 2008 Jan 1;18(1):39-43. Epub 2007 Nov 13.Synthesis and biological activity of piperazine and diazepane amides that are histamine H3 antagonists and serotonin reuptake inhibitors. | ||||
| Ref 529212 | Bioorg Med Chem Lett. 2008 Jan 1;18(1):355-9. Epub 2007 Oct 24.In vitro SAR of pyrrolidine-containing histamine H3 receptor antagonists: trends across multiple chemical series. | ||||
| Ref 529387 | J Med Chem. 2008 Apr 24;51(8):2457-67. Epub 2008 Mar 22.Fragment based design of new H4 receptor-ligands with anti-inflammatory properties in vivo. | ||||
| Ref 529576 | Synthesis, structure-activity relationships, and biological profiles of a quinazolinone class of histamine H3 receptor inverse agonists. J Med Chem. 2008 Aug 14;51(15):4780-9. | ||||
| Ref 529632 | J Med Chem. 2008 Sep 11;51(17):5423-30. Epub 2008 Aug 7.The alkaloid conessine and analogues as potent histamine H3 receptor antagonists. | ||||
| Ref 529673 | Bioorg Med Chem. 2008 Sep 15;16(18):8729-36. Epub 2008 Jul 29.Piperidine variations in search for non-imidazole histamine H(3) receptor ligands. | ||||
| Ref 529751 | Bioorg Med Chem Lett. 2008 Nov 1;18(21):5796-9. Epub 2008 Sep 24.2-Aryloxymethylmorpholine histamine H(3) antagonists. | ||||
| Ref 530019 | Bioorg Med Chem Lett. 2009 Apr 15;19(8):2172-5. Epub 2009 Mar 3.Fluorinated non-imidazole histamine H3 receptor antagonists. | ||||
| Ref 530044 | Bioorg Med Chem. 2009 Apr 15;17(8):3037-42. Epub 2009 Mar 14.Diether derivatives of homo- or substituted piperidines as non-imidazole histamine H3 receptor ligands. | ||||
| Ref 530151 | J Med Chem. 2009 Jul 9;52(13):3855-68.5-hydroxyindole-2-carboxylic acid amides: novel histamine-3 receptor inverse agonists for the treatment of obesity. | ||||
| Ref 530254 | J Med Chem. 2009 Aug 13;52(15):4640-9.Design of a new histamine H3 receptor antagonist chemotype: (3aR,6aR)-5-alkyl-1-aryl-octahydropyrrolo[3,4-b]pyrroles, synthesis, and structure-activity relationships. | ||||
| Ref 530397 | Bioorg Med Chem Lett. 2009 Nov 1;19(21):6176-80. Epub 2009 Sep 6.Synthesis and structure-activity relationships of 2-(1,4'-bipiperidin-1'-yl)thiazolopyridine as H3 receptor antagonists. | ||||
| Ref 530465 | Bioorg Med Chem Lett. 2009 Dec 1;19(23):6682-5. Epub 2009 Oct 6.Histamine H3 and H4 receptor affinity of branched 3-(1H-imidazol-4-yl)propyl N-alkylcarbamates. | ||||
| Ref 530846 | J Med Chem. 2010 May 13;53(9):3840-4.Role of hydrophobic substituents on the terminal nitrogen of histamine in receptor binding and agonist activity: development of an orally active histamine type 3 receptor agonist and evaluation of its antistress activity in mice. | ||||
| Ref 530904 | Bioorg Med Chem Lett. 2010 Jun 1;20(11):3295-300. Epub 2010 Apr 18.In vitro studies on a class of quinoline containing histamine H3 antagonists. | ||||
| Ref 531079 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
| Ref 531088 | J Med Chem. 2010 Sep 9;53(17):6445-56.Investigation of the histamine H3 receptor binding site. Design and synthesis of hybrid agonists with a lipophilic side chain. | ||||
| Ref 531116 | Bioorg Med Chem Lett. 2010 Oct 1;20(19):5883-6. Epub 2010 Aug 1.Azole derivatives as histamine H3 receptor antagonists, part 2: C-C and C-S coupled heterocycles. | ||||
| Ref 531268 | JNJ-39220675, a novel selective histamine H3 receptor antagonist, reduces the abuse-related effects of alcohol in rats. Psychopharmacology (Berl). 2011 Apr;214(4):829-41. | ||||
| Ref 531503 | Additive effects of a cholinesterase inhibitor and a histamine inverse agonist on scopolamine deficits in humans. Psychopharmacology (Berl). 2011 Dec;218(3):513-24. | ||||
| Ref 531661 | CEP-26401 (irdabisant), a potent and selective histamine H??receptor antagonist/inverse agonist with cognition-enhancing and wake-promoting activities. J Pharmacol Exp Ther. 2012 Jan;340(1):124-33. | ||||
| Ref 531737 | Identification of biaryl sulfone derivatives as antagonists of the histamine H??receptor: discovery of (R)-1-(2-(4'-(3-methoxypropylsulfonyl)biphenyl-4-yl)ethyl)-2-methylpyrrolidine (APD916). Bioorg Med Chem Lett. 2012 Jan 1;22(1):71-5. | ||||
| Ref 531879 | Randomized clinical study of a histamine H3 receptor antagonist for the treatment of adults with attention-deficit hyperactivity disorder. CNS Drugs. 2012 May 1;26(5):421-34. | ||||
| Ref 531888 | SAR110894, a potent histamine H??receptor antagonist, displays procognitive effects in rodents. Pharmacol Biochem Behav. 2012 Aug;102(2):203-14. | ||||
| Ref 532509 | Early-stage comparative effectiveness: randomized controlled trial with histamine inverse agonist MK-7288 in excessive daytime sleepiness patients. J Clin Pharmacol. 2013 Dec;53(12):1294-302. | ||||
| Ref 532787 | Effects of pitolisant, a histamine H3 inverse agonist, in drug-resistant idiopathic and symptomatic hypersomnia: a chart review. Sleep Med. 2014 Jun;15(6):681-7. | ||||
| Ref 533720 | J Med Chem. 1995 May 12;38(10):1593-9.A novel pyrrolidine analog of histamine as a potent, highly selective histamine H3 receptor agonist. | ||||
| Ref 533760 | Characterization of the binding of the first selective radiolabelled histamine H3-receptor antagonist, [125I]-iodophenpropit, to rat brain. Br J Pharmacol. 1994 Oct;113(2):355-62. | ||||
| Ref 534203 | Sleep and waking during acute histamine H3 agonist BP 2.94 or H3 antagonist carboperamide (MR 16155) administration in rats. Neuropsychopharmacology. 1996 Jul;15(1):31-5. | ||||
| Ref 534790 | Bioorg Med Chem Lett. 1998 May 19;8(10):1133-8.New acetylene based histamine H3 receptor antagonists derived from the marine natural product verongamine. | ||||
| Ref 534934 | Combined histamine H1 and H3 receptor blockade produces nasal decongestion in an experimental model of nasal congestion. Am J Rhinol. 1999 Sep-Oct;13(5):391-9. | ||||
| Ref 535111 | Cloning and pharmacological characterization of a fourth histamine receptor (H(4)) expressed in bone marrow. Mol Pharmacol. 2001 Mar;59(3):420-6. | ||||
| Ref 535262 | Azomethine prodrugs of (R)-alpha-methylhistamine, a highly potent and selective histamine H3-receptor agonist. Curr Med Chem. 2001 Sep;8(11):1329-40. | ||||
| Ref 536039 | The histamine H3 receptor: from gene cloning to H3 receptor drugs. Nat Rev Drug Discov. 2005 Feb;4(2):107-20. | ||||
| Ref 536066 | G protein-dependent pharmacology of histamine H3 receptor ligands: evidence for heterogeneous active state receptor conformations. J Pharmacol Exp Ther. 2005 Jul;314(1):271-81. Epub 2005 Apr 8. | ||||
| Ref 536225 | Emerging drugs for eating disorder treatment. Expert Opin Emerg Drugs. 2006 May;11(2):315-36. | ||||
| Ref 536761 | A robust and high-capacity [(35)S]GTPgammaS binding assay for determining antagonist and inverse agonist pharmacological parameters of histamine H(3) receptor ligands. Assay Drug Dev Technol. 2008 Jun;6(3):339-49. | ||||
| Ref 537279 | Use of the H3 receptor antagonist radioligand [3H]-A-349821 to reveal in vivo receptor occupancy of cognition enhancing H3 receptor antagonists. Br J Pharmacol. 2009 May;157(1):139-49. | ||||
| Ref 543673 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 264). | ||||
| Ref 549101 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032225) | ||||
| Ref 551227 | Synthesis and structure-activity relationships of N-aryl-piperidine derivatives as potent (partial) agonists for human histamine H3 receptor. Bioorg Med Chem. 2010 Jul 15;18(14):5441-8. doi: 10.1016/j.bmc.2010.04.052. Epub 2010 Apr 21. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.