Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T22118
|
||||
Former ID |
TTDS00011
|
||||
Target Name |
Dopamine D1 receptor
|
||||
Gene Name |
DRD1
|
||||
Synonyms |
D(1) dopamine receptor; D(1A) dopamine receptor; DRD1
|
||||
Target Type |
Successful
|
||||
Disease | Allergy [ICD9: 995.3; ICD10: T78.4] | ||||
Cocaine addiction [ICD9: 304.2; ICD10: F14.2] | |||||
Cognitive disorders [ICD9: 290-294, 294.0, 780.09, 780.9, 780.93; ICD10: F01-F07, F04, F05, R41.3] | |||||
Dementia [ICD9: 290-294; ICD10: F01-F07] | |||||
Excessive bleeding following childbirth and spontaneous or elective abortion [ICD10: O04] | |||||
Glaucoma [ICD9: 365; ICD10: H40-H42] | |||||
Hypertension [ICD9: 401; ICD10: I10-I16] | |||||
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
Psychotic disorders [ICD9: 290-299; ICD10: F20-F29] | |||||
Psychiatric disorder [ICD9: 290-319; ICD10: F01-F99] | |||||
Parkinson's disease [ICD9: 332; ICD10: G20] | |||||
Schizophrenia [ICD9: 295; ICD10: F20] | |||||
Sexual dysfunction [ICD9: 302.7; ICD10: F52] | |||||
Substance dependence [ICD10: F10-F19] | |||||
Type 2 diabetes [ICD9: 250; ICD10: E11] | |||||
Unspecified [ICD code not available] | |||||
Function |
Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
Target Validation |
T22118
|
||||
UniProt ID | |||||
Sequence |
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL SVILDYDTDVSLEKIQPITQNGQHPT |
||||
Drugs and Mode of Action | |||||
Drug(s) | Fenoldopam | Drug Info | Approved | Hypertension | [536361], [543348] |
Methylergonovine | Drug Info | Approved | Excessive bleeding following childbirth and spontaneous or elective abortion | [551871] | |
Pergolide | Drug Info | Approved | Parkinson's disease | [468029], [536285] | |
Phenyltoloxamine | Drug Info | Approved | Allergy | [551871] | |
Ecopipam | Drug Info | Phase 3 | Cocaine addiction | [524163], [540266] | |
Zicronapine | Drug Info | Phase 3 | Schizophrenia | [523357] | |
DAS-431 IV | Drug Info | Phase 2 | Dementia | [551849] | |
Intranasal apomorphine | Drug Info | Phase 2 | Sexual dysfunction | [527086] | |
Dihydrexidine | Drug Info | Phase 1/2 | Psychotic disorders | [532900] | |
BSF-78438 | Drug Info | Preclinical | Schizophrenia | [536463] | |
D1 agonist D2 antagonist | Drug Info | Preclinical | Schizophrenia | [536463] | |
ADROGOLIDE HYDROCHLORIDE | Drug Info | Discontinued in Phase 2 | Cognitive disorders | [546145] | |
ADX-10061 | Drug Info | Discontinued in Phase 2 | Psychotic disorders | [544910] | |
BAM-1110 | Drug Info | Discontinued in Phase 2 | Parkinson's disease | [545888] | |
CY-208243 | Drug Info | Discontinued in Phase 2 | Pain | [528994] | |
ZELANDOPAM HYDROCHLORIDE | Drug Info | Discontinued in Phase 2 | Hypertension | [545254] | |
Berupipam | Drug Info | Discontinued in Phase 1 | Psychotic disorders | [545634] | |
BTS-73947 | Drug Info | Discontinued in Phase 1 | Psychotic disorders | [546424] | |
Odapipam | Drug Info | Discontinued in Phase 1 | Psychotic disorders | [546051] | |
SDZ-GLC-756 | Drug Info | Discontinued in Phase 1 | Glaucoma | [546521] | |
A 77636 | Drug Info | Terminated | Parkinson's disease | [545188] | |
A-68930 | Drug Info | Terminated | Hypertension | [541323], [545191] | |
A-69024 | Drug Info | Terminated | Psychotic disorders | [545268] | |
BIMG80 | Drug Info | Terminated | Psychotic disorders | [546146] | |
CEE-03-320 | Drug Info | Terminated | Substance dependence | [546271] | |
NNC-22-0031 | Drug Info | Terminated | Psychotic disorders | [534327] | |
Org-10490 | Drug Info | Terminated | Psychotic disorders | [551630] | |
SDZ-PSD-958 | Drug Info | Terminated | Psychiatric disorder | [546576] | |
SKF 38393 | Drug Info | Terminated | Type 2 diabetes | [525668], [543309] | |
SKF-81297 | Drug Info | Terminated | Parkinson's disease | [543311], [545672] | |
Inhibitor | (+)-(1R,1'S)-berbamunine hydrochloride | Drug Info | [551356] | ||
(+)-(1R,1'S)-thaligrisine hydrochloride | Drug Info | [551356] | |||
(+)-BUTACLAMOL | Drug Info | [525773] | |||
(+/-)-nantenine | Drug Info | [530558] | |||
(-)-(1S,1'R)-O,O-dimethylgrisbine hydrochloride | Drug Info | [551356] | |||
(R)-(+)-coclaurine | Drug Info | [534656] | |||
(R)-(-)-10-methyl-11-hydroxyaporphine | Drug Info | [528876] | |||
(R)-(-)-11-hydroxy-N-n-propylnoraporphine | Drug Info | [529289] | |||
(R)-(-)-2-methoxy-11-hydroxyaporphine | Drug Info | [529289] | |||
(R)-(-)-2-methoxy-N-npropylnorapomorphine | Drug Info | [529289] | |||
(R)-(-)-N-ethyl-2-methoxy-11-hydroxynoraporphine | Drug Info | [529289] | |||
(R)-(-)-N-propyl-2-methoxy-11-hydroxynoraporphine | Drug Info | [529289] | |||
(R)-11-Amino-2-methoxyaporphine | Drug Info | [529541] | |||
(R)-2,11-Diaminoaporphine | Drug Info | [529541] | |||
(R,S)-homoaromaline hydrochloride | Drug Info | [551356] | |||
(S)-BULBOCAPNINE | Drug Info | [528616] | |||
(S)APOMORPHINE | Drug Info | [530342] | |||
(S,S)-oxandrine hydrochloride | Drug Info | [551356] | |||
1,2,3,7,12,12a-hexahydro-1-aza-pleiaden-5-ol | Drug Info | [528616] | |||
1,2,3,7,12,12a-hexahydro-1-aza-pleiadene-5,6-diol | Drug Info | [528616] | |||
1,2-Bis-[R-(-)-apomorphine-2'-oxy]ethane | Drug Info | [529349] | |||
1-(4-(1H-pyrazol-1-yl)benzyl)-4-phenylpiperazine | Drug Info | [528099] | |||
1-Aminomethyl-3-cyclohexyl-isochroman-5,6-diol | Drug Info | [529371] | |||
1-Aminomethyl-3-phenyl-isochroman-5,6-diol | Drug Info | [530404] | |||
1-Aminomethyl-isochroman-5,6-diol | Drug Info | [530404] | |||
1-Benzyl-4-(2-ethynyl-pyrrol-1-yl)-piperidine | Drug Info | [525629] | |||
1-Benzyl-4-(2-iodo-pyrrol-1-yl)-piperidine | Drug Info | [525629] | |||
1-Benzyl-4-(2-oxazol-5-yl-pyrrol-1-yl)-piperidine | Drug Info | [525629] | |||
1-Dibenzo[b,f]oxepin-10-yl-4-methyl-piperazine | Drug Info | [533570] | |||
1-[2-(2-Benzyl-phenoxy)-ethyl]-piperidine | Drug Info | [527160] | |||
1-[2-(2-Benzyl-phenoxy)-ethyl]-pyrrolidine | Drug Info | [527160] | |||
1-[3-(2-Benzyl-phenoxy)-propyl]-pyrrolidine | Drug Info | [527160] | |||
11-Butyryloxy-N-n-propylnoraporphine | Drug Info | [529686] | |||
11-Heptanoyloxy-N-n-propylnoraporphine | Drug Info | [529686] | |||
11-Hexanoyloxy-N-n-propylnoraporphine | Drug Info | [529686] | |||
11-Propionyloxy-N-n-propylnoraporphine | Drug Info | [529686] | |||
11-valeryloxynoraporphine | Drug Info | [529686] | |||
2-methoxyapomorphine | Drug Info | [529349] | |||
2-Methyl-8-phenyl-1,2,3,4-tetrahydro-isoquinoline | Drug Info | [533578] | |||
2-{[R-(-)-Apomorphine-2'-oxy]ethoxy}-ethanol | Drug Info | [529349] | |||
3,8-dibromoboldine | Drug Info | [525759] | |||
3-bromoboldine | Drug Info | [525759] | |||
3-Chloroboldine | Drug Info | [525759] | |||
3-Iodoboldine | Drug Info | [525759] | |||
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [531079] | |||
4-[2-(2-Benzyl-phenoxy)-ethyl]-morpholine | Drug Info | [527160] | |||
5-(2-Amino-ethyl)-2-chloro-phenol hydrobromide | Drug Info | [526782] | |||
6-(2-Amino-ethyl)-biphenyl-2,3,4'-triol | Drug Info | [533481] | |||
6-(2-Amino-ethyl)-biphenyl-2,3-diol | Drug Info | [533481] | |||
6-(2-Dipropylamino-ethyl)-biphenyl-2,3,4'-triol | Drug Info | [533481] | |||
6-(2-Dipropylamino-ethyl)-biphenyl-2,3-diol | Drug Info | [533481] | |||
9-Aminomethyl-9H-fluorene-2,5,6-triol | Drug Info | [533481] | |||
9-Aminomethyl-9H-fluorene-3,4-diol | Drug Info | [533481] | |||
A-70108 | Drug Info | [530404] | |||
BOLDINE | Drug Info | [525759] | |||
Dihydrexidine | Drug Info | [528571] | |||
Etoloxamine | Drug Info | [527160] | |||
FALCARINDIOL | Drug Info | [529238] | |||
FLUMEZAPINE | Drug Info | [533515] | |||
FLUTROLINE | Drug Info | [533512] | |||
GLAUCINE | Drug Info | [528616] | |||
IBZM | Drug Info | [529011] | |||
ISOCLOZAPINE | Drug Info | [534532] | |||
ISOLOXAPINE | Drug Info | [533577] | |||
MCL-516 | Drug Info | [529850] | |||
MELOSMINE | Drug Info | [528616] | |||
N-(4-Dipropylaminobutyl)-4-biphenylcarboxamide | Drug Info | [529734] | |||
N-(4-Propylaminobutyl)-4-biphenylcarboxamide | Drug Info | [529734] | |||
NORSTEPHALAGINE | Drug Info | [528616] | |||
Phenyltoloxamine | Drug Info | [527160] | |||
PUKATEINE | Drug Info | [528616] | |||
QUINPIROLE | Drug Info | [527714] | |||
R-N-PROPYLNORAPOMORPHINE | Drug Info | [529289] | |||
Ro-21-7767 | Drug Info | [533759] | |||
SB-271046 | Drug Info | [529191] | |||
SCH-12679 | Drug Info | [534738] | |||
SCH-24518 | Drug Info | [533416] | |||
SK&F-89626 | Drug Info | [530341] | |||
STEPHOLIDINE | Drug Info | [530374] | |||
TEPA (possesses cytotoxic activity) | Drug Info | [534719] | |||
[R-(-)-Apomorphine-2-yl]-(2'-hydroxy-ethyl)ether | Drug Info | [529349] | |||
Agonist | (+)-ADTN | Drug Info | [529311] | ||
ADROGOLIDE HYDROCHLORIDE | Drug Info | [526175], [551871] | |||
CY-208243 | Drug Info | [533392] | |||
D1 agonist D2 antagonist | Drug Info | [536463] | |||
DAS-431 IV | Drug Info | [526175] | |||
Fenoldopam | Drug Info | [536760] | |||
Intranasal apomorphine | Drug Info | [534197] | |||
N-propylnorapomorphine | Drug Info | [529311] | |||
SKF-75670 | Drug Info | [530363] | |||
SKF-83959 | Drug Info | [533137] | |||
Modulator | A 77636 | Drug Info | |||
A-68930 | Drug Info | [526771] | |||
A-69024 | Drug Info | [526304] | |||
BAM-1110 | Drug Info | ||||
BIMG80 | Drug Info | [534408] | |||
CEE-03-320 | Drug Info | [546272] | |||
Ecopipam | Drug Info | ||||
ecopipam (controlled-release, Lesch Nyhan syndrome/Tourette's syndrome/compulsive gambling). Psyadon Pharmaceuticals | Drug Info | ||||
NNC-22-0031 | Drug Info | [534327] | |||
Org-10490 | Drug Info | [556264] | |||
Pergolide | Drug Info | [556264] | |||
SDZ-GLC-756 | Drug Info | [534322] | |||
SDZ-PSD-958 | Drug Info | [534179] | |||
SKF 38393 | Drug Info | [525668] | |||
SKF-81297 | Drug Info | [533794] | |||
Zicronapine | Drug Info | [549861] | |||
Antagonist | ADX-10061 | Drug Info | [544911] | ||
Berupipam | Drug Info | [533594] | |||
BTS-73947 | Drug Info | [546425], [551871] | |||
Methylergonovine | Drug Info | [536092] | |||
Odapipam | Drug Info | [525486] | |||
SCH-23390 | Drug Info | [537186] | |||
SKF-83556 | Drug Info | [529311] | |||
ZELANDOPAM HYDROCHLORIDE | Drug Info | [527452], [551871] | |||
[125I]SCH23982 | Drug Info | [531411] | |||
[3H]SCH-23390 | Drug Info | [531521] | |||
Binder | BSF-78438 | Drug Info | [536463] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Calcium signaling pathway | ||||
cAMP signaling pathway | |||||
Neuroactive ligand-receptor interaction | |||||
Gap junction | |||||
Dopaminergic synapse | |||||
Parkinson' | |||||
s disease | |||||
Cocaine addiction | |||||
Amphetamine addiction | |||||
Morphine addiction | |||||
Alcoholism | |||||
PANTHER Pathway | Dopamine receptor mediated signaling pathway | ||||
PathWhiz Pathway | Dopamine Activation of Neurological Reward System | ||||
Reactome | Dopamine receptors | ||||
G alpha (s) signalling events | |||||
WikiPathways | Hypothetical Network for Drug Addiction | ||||
Monoamine GPCRs | |||||
GPCRs, Class A Rhodopsin-like | |||||
Genes and (Common) Pathways Underlying Drug Addiction | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
References | |||||
Ref 468029 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 48). | ||||
Ref 523357 | ClinicalTrials.gov (NCT01295372) Safety and Efficacy of Zicronapine in Patients With Schizophrenia. U.S. National Institutes of Health. | ||||
Ref 524163 | ClinicalTrials.gov (NCT01751802) Ecopipam Treatment of Self-Injurious Behavior in Subjects With Lesch-Nyhan Disease. U.S. National Institutes of Health. | ||||
Ref 525668 | The D1 dopamine receptor agonist SKF-38393 stimulates the release of glutamate in the hippocampus. Neuroscience. 1999;94(4):1063-70. | ||||
Ref 528994 | Decrease of behavioral and biochemical denervation supersensitivity of rat striatum by nigral transplants. Neuroscience. 1991;44(1):75-83. | ||||
Ref 532900 | Effects of the D1 dopamine receptor agonist dihydrexidine (DAR-0100A) on working memory in schizotypal personality disorder. Neuropsychopharmacology. 2015 Jan;40(2):446-53. | ||||
Ref 534327 | NNC-19-1228 and NNC 22-0031, novel neuroleptics with a "mesolimbic-selective" behavioral profile. Psychopharmacology (Berl). 1997 Jan;129(2):168-78. | ||||
Ref 536285 | Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54. | ||||
Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
Ref 536463 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31. | ||||
Ref 540266 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3304). | ||||
Ref 541323 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6077). | ||||
Ref 543309 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 935). | ||||
Ref 543311 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 938). | ||||
Ref 543348 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 985). | ||||
Ref 544910 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001476) | ||||
Ref 545188 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002413) | ||||
Ref 545191 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002423) | ||||
Ref 545254 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002584) | ||||
Ref 545268 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002637) | ||||
Ref 545634 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004006) | ||||
Ref 545672 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004119) | ||||
Ref 545888 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005232) | ||||
Ref 546051 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006052) | ||||
Ref 546145 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006590) | ||||
Ref 546146 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006596) | ||||
Ref 546271 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007189) | ||||
Ref 546424 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008043) | ||||
Ref 546521 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008736) | ||||
Ref 546576 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009027) | ||||
Ref 525486 | PET studies of binding competition between endogenous dopamine and the D1 radiotracer [11C]NNC 756. Synapse. 1999 May;32(2):93-109. | ||||
Ref 525629 | Bioorg Med Chem Lett. 1999 Nov 1;9(21):3143-6.Piperidinylpyrroles: design, synthesis and binding properties of novel and selective dopamine D4 receptor ligands. | ||||
Ref 525668 | The D1 dopamine receptor agonist SKF-38393 stimulates the release of glutamate in the hippocampus. Neuroscience. 1999;94(4):1063-70. | ||||
Ref 525759 | J Nat Prod. 2000 Apr;63(4):480-4.Halogenated boldine derivatives with enhanced monoamine receptor selectivity. | ||||
Ref 525773 | J Med Chem. 2000 May 18;43(10):2079-81.7-Methyl-6,7,8,9,14,15-hexahydro-5H-benz[d]indolo[2,3-g]azecine: a new heterocyclic system and a new lead compound for dopamine receptor antagonists. | ||||
Ref 526175 | Adrogolide HCl (ABT-431; DAS-431), a prodrug of the dopamine D1 receptor agonist, A-86929: preclinical pharmacology and clinical data. CNS Drug Rev. 2001 Fall;7(3):305-16. | ||||
Ref 526304 | (+)-[76Br]A-69024: a non-benzazepine radioligand for studies of dopamine D1 receptors using PET. Nucl Med Biol. 2002 Apr;29(3):295-302. | ||||
Ref 526771 | Comparison of the D1-dopamine agonists SKF-38393 and A-68930 in neonatal 6-hydroxydopamine-lesioned rats: behavioral effects and induction of c-fos-like immunoreactivity. J Pharmacol Exp Ther. 1992 Aug;262(2):855-65. | ||||
Ref 526782 | J Med Chem. 1992 Nov 13;35(23):4408-14.Synthesis and pharmacological characterization of 2-(4-chloro-3-hydroxyphenyl)ethylamine and N,N-dialkyl derivatives as dopamine receptor ligands. | ||||
Ref 527160 | J Med Chem. 2004 Aug 12;47(17):4155-8.Dopamine/serotonin receptor ligands. 9. Oxygen-containing midsized heterocyclic ring systems and nonrigidized analogues. A step toward dopamine D5 receptor selectivity. | ||||
Ref 527452 | Effect of zelandopam, a dopamine D1-like receptor agonist, in puromycin aminonucleoside nephrosis rats. Eur J Pharmacol. 2005 Mar 7;510(1-2):121-6. | ||||
Ref 527714 | J Med Chem. 2005 Sep 8;48(18):5771-9.Pharmacophore-guided drug discovery investigations leading to bioactive 5-aminotetrahydropyrazolopyridines. Implications for the binding mode of heterocyclic dopamine D3 receptor agonists. | ||||
Ref 528099 | Bioorg Med Chem Lett. 2006 Jun 1;16(11):2955-9. Epub 2006 Mar 24.Synthesis and biological investigations of dopaminergic partial agonists preferentially recognizing the D4 receptor subtype. | ||||
Ref 528571 | J Med Chem. 2006 Nov 16;49(23):6848-57.trans-2,3-dihydroxy-6a,7,8,12b-tetrahydro-6H-chromeno[3,4-c]isoquinoline: synthesis, resolution, and preliminary pharmacological characterization of a new dopamine D1 receptor full agonist. | ||||
Ref 528616 | J Med Chem. 2007 Jan 25;50(2):171-81.Advances in development of dopaminergic aporphinoids. | ||||
Ref 528876 | Bioorg Med Chem Lett. 2007 Aug 1;17(15):4128-30. Epub 2007 May 23.R-(-)-N-alkyl-11-hydroxy-10-hydroxymethyl- and 10-methyl-aporphines as 5-HT1A receptor ligands. | ||||
Ref 529011 | Bioorg Med Chem. 2007 Nov 1;15(21):6819-29. Epub 2007 Aug 19.In vitro affinities of various halogenated benzamide derivatives as potential radioligands for non-invasive quantification of D(2)-like dopamine receptors. | ||||
Ref 529191 | Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43. Epub 2007 Nov 17.Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. | ||||
Ref 529238 | Bioorg Med Chem. 2008 Mar 15;16(6):3218-23. Epub 2007 Dec 31.Novel coumarin glycoside and phenethyl vanillate from Notopterygium forbesii and their binding affinities for opioid and dopamine receptors. | ||||
Ref 529289 | J Med Chem. 2008 Feb 28;51(4):983-7. Epub 2008 Feb 6.Synthesis and dopamine receptor affinities of N-alkyl-11-hydroxy-2-methoxynoraporphines: N-alkyl substituents determine D1 versus D2 receptor selectivity. | ||||
Ref 529311 | Cloning of the gene for a human dopamine D5 receptor with higher affinity for dopamine than D1. Nature. 1991 Apr 18;350(6319):614-9. | ||||
Ref 529349 | Bioorg Med Chem. 2008 Apr 15;16(8):4563-8. Epub 2008 Feb 15.Synthesis and neuropharmacological characterization of 2-O-substituted apomorphines. | ||||
Ref 529371 | J Med Chem. 1991 Oct;34(10):2946-53.Synthesis and pharmacological evaluation of 1-(aminomethyl)-3,4-dihydro-5-hydroxy-1H-2-benzopyrans as dopamine D1 selective ligands. | ||||
Ref 529541 | Bioorg Med Chem. 2008 Jul 15;16(14):6675-81. Epub 2008 Jun 5.Synthesis and pharmacological investigation of novel 2-aminothiazole-privileged aporphines. | ||||
Ref 529686 | Bioorg Med Chem. 2008 Sep 15;16(18):8335-8. Epub 2008 Aug 28.N-Propylnoraporphin-11-O-yl carboxylic esters as potent dopamine D(2) and serotonin 5-HT(1A) receptor dual ligands. | ||||
Ref 529734 | J Med Chem. 2008 Nov 13;51(21):6829-38. Epub 2008 Oct 4.Novel D3 selective dopaminergics incorporating enyne units as nonaromatic catechol bioisosteres: synthesis, bioactivity, and mutagenesis studies. | ||||
Ref 529850 | Bioorg Med Chem Lett. 2009 Jan 1;19(1):51-3. Epub 2008 Nov 13.Synthesis and neuropharmacological evaluation of esters of R(-)-N-alkyl-11-hydroxy-2-methoxynoraporphines. | ||||
Ref 530341 | J Med Chem. 1990 Jun;33(6):1756-64.trans-10,11-dihydroxy-5,6,6a,7,8,12b-hexahydrobenzo[a]phenanthridine: a highly potent selective dopamine D1 full agonist. | ||||
Ref 530342 | J Med Chem. 1990 Jun;33(6):1800-5.Synthesis and dopamine receptor affinities of enantiomers of 2-substituted apomorphines and their N-n-propyl analogues. | ||||
Ref 530363 | Dopamine receptor agonists: selectivity and dopamine D1 receptor efficacy. Eur J Pharmacol. 1990 Jun 12;188(6):335-47. | ||||
Ref 530374 | Bioorg Med Chem. 2009 Oct 1;17(19):6898-907. Epub 2009 Aug 20.Dibenzazecine scaffold rebuilding--is the flexibility always essential for high dopamine receptor affinities?. | ||||
Ref 530404 | J Med Chem. 1990 Nov;33(11):2948-50.(1R,3S)-1-(aminomethyl)-3,4-dihydro-5,6-dihydroxy-3-phenyl-1H-2-benzopyran: a potent and selective D1 agonist. | ||||
Ref 530558 | Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. | ||||
Ref 531079 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
Ref 531411 | Molecular cloning and expression of the gene for a human D1 dopamine receptor. Nature. 1990 Sep 6;347(6288):72-6. | ||||
Ref 531521 | Cloning and expression of human and rat D1 dopamine receptors. Nature. 1990 Sep 6;347(6288):76-80. | ||||
Ref 533137 | Identification of G protein-biased agonists that fail to recruit beta-arrestin or promote internalization of the D1 dopamine receptor. ACS Chem Neurosci. 2015 Apr 15;6(4):681-92. | ||||
Ref 533392 | The D-1 dopamine receptor partial agonist, CY 208-243, exhibits antiparkinsonian activity in the MPTP-treated marmoset. Eur J Pharmacol. 1988 Nov 1;156(2):197-206. | ||||
Ref 533416 | J Med Chem. 1988 Oct;31(10):1941-6.Synthesis and pharmacological characterization of 1-phenyl-, 4-phenyl-, and 1-benzyl-1,2,3,4-tetrahydroisoquinolines as dopamine receptor ligands. | ||||
Ref 533481 | J Med Chem. 1986 Oct;29(10):1904-12.Synthesis and dopaminergic binding of 2-aryldopamine analogues: phenethylamines, 3-benzazepines, and 9-(aminomethyl)fluorenes. | ||||
Ref 533512 | J Med Chem. 1980 Jun;23(6):635-43.Neuroleptic activity in 5-aryltetrahydro-gamma-carbolines. | ||||
Ref 533515 | J Med Chem. 1982 Oct;25(10):1133-40.Effects of conformationally restricted 4-piperazinyl-10H-thienobenzodiazepine neuroleptics on central dopaminergic and cholinergic systems. | ||||
Ref 533570 | J Med Chem. 1982 Jul;25(7):855-8.Affinity of 10-(4-methylpiperazino)dibenz[b,f]oxepins for clozapine and spiroperidol binding sites in rat brain. | ||||
Ref 533577 | J Med Chem. 1981 Sep;24(9):1021-6.Synthesis of clozapine analogues and their affinity for clozapine and spiroperidol binding sites in rat brain. | ||||
Ref 533578 | J Med Chem. 1981 Sep;24(9):1107-10.Synthesis and evaluation of 1,2,3,4-tetrahydro[1]benzothieno[2,3-h]isoquinolines as dopamine antagonists. | ||||
Ref 533594 | Characterization of benzazepine UDP-glucuronosyl-transferases in laboratory animals and man. Xenobiotica. 1995 Jun;25(6):611-22. | ||||
Ref 533759 | J Med Chem. 1995 Jan 20;38(2):318-27.Evaluation of cis- and trans-9- and 11-hydroxy-5,6,6a,7,8,12b-hexahydrobenzo[a]phenanthridines as structurally rigid, selective D1 dopamine receptor ligands. | ||||
Ref 533794 | Dopamine D1 receptor involvement in the discriminative-stimulus effects of SKF 81297 in squirrel monkeys. J Pharmacol Exp Ther. 1993 Nov;267(2):765-75. | ||||
Ref 534179 | SDZ PSD 958, a novel D1 receptor antagonist with potential limbic selectivity. J Neural Transm. 1996;103(3):261-76. | ||||
Ref 534197 | Dopamine agonists used in the treatment of Parkinson's disease and their selectivity for the D1, D2, and D3 dopamine receptors in human striatum. Prog Neuropsychopharmacol Biol Psychiatry. 1995 Nov;19(7):1147-54. | ||||
Ref 534322 | SDZ GLC 756, a novel octahydrobenzo[g]quinoline derivative exerts opposing effects on dopamine D1 and D2 receptors. J Neural Transm. 1996;103(1-2):17-30. | ||||
Ref 534327 | NNC-19-1228 and NNC 22-0031, novel neuroleptics with a "mesolimbic-selective" behavioral profile. Psychopharmacology (Berl). 1997 Jan;129(2):168-78. | ||||
Ref 534408 | BIMG 80, a novel potential antipsychotic drug: evidence for multireceptor actions and preferential release of dopamine in prefrontal cortex. J Neurochem. 1997 Jul;69(1):182-90. | ||||
Ref 534532 | J Med Chem. 1997 Dec 5;40(25):4146-53.Synthesis and pharmacological evaluation of triflate-substituted analogues of clozapine: identification of a novel atypical neuroleptic. | ||||
Ref 534656 | J Nat Prod. 1998 Jun 26;61(6):709-12.Synthesis and dopamine receptor selectivity of the benzyltetrahydroisoquinoline, (R)-(+)-nor-roefractine. | ||||
Ref 534719 | J Med Chem. 1998 Oct 8;41(21):4165-70.N-(Iodopropenyl)-octahydrobenzo[f]- and -[g]quinolines: synthesis and adrenergic and dopaminergic activity studies. | ||||
Ref 534738 | J Med Chem. 1998 Nov 5;41(23):4486-91.Modified ibogaine fragments: synthesis and preliminary pharmacological characterization of 3-ethyl-5-phenyl-1,2,3,4,5, 6-hexahydroazepino[4,5-b]benzothiophenes. | ||||
Ref 536092 | Reinforcement in an in vitro analog of appetitive classical conditioning of feeding behavior in Aplysia: blockade by a dopamine antagonist. Learn Mem. 2005 May-Jun;12(3):216-20. | ||||
Ref 536463 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31. | ||||
Ref 536760 | Etiology of iodinated radiocontrast nephrotoxicity and its attenuation by beraprost. Yakugaku Zasshi. 2008 Jul;128(7):1023-9. | ||||
Ref 537186 | Dopamine modulates effort-based decision making in rats. Behav Neurosci. 2009 Apr;123(2):242-51. | ||||
Ref 544911 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001476) | ||||
Ref 546272 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007189) | ||||
Ref 546425 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008043) | ||||
Ref 551356 | Displacement activity of bisbenzylisoquinoline alkaloids at striatal 3H-SCH 23390 and 3H-raclopride binding sites. J Nat Prod. 1992 Sep;55(9):1281-6. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.