Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T30082
|
||||
Former ID |
TTDS00140
|
||||
Target Name |
Acetylcholinesterase
|
||||
Gene Name |
ACHE
|
||||
Synonyms |
AChE; ACHE
|
||||
Target Type |
Successful
|
||||
Disease | Alzheimer disease; Mild cognitive impairment [ICD9: 331.0, 331.83; ICD10: F06.7, G30, G31.84] | ||||
Alcohol use disorders [ICD9: 303; ICD10: F10.2] | |||||
Alzheimer disease [ICD9: 331; ICD10: G30] | |||||
Cognitive disorders [ICD9: 290-294, 294.0, 780.09, 780.9, 780.93; ICD10: F01-F07, F04, F05, R41.3] | |||||
Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
Chronic glaucoma [ICD9: 365; ICD10: H40-H42] | |||||
Epileptic seizures; Alzheimer disease [ICD9:345.9, 780.3, 331; ICD10: G40, P90, R56, G30] | |||||
Glaucoma [ICD9: 365; ICD10: H40-H42] | |||||
Helminth infection [ICD9: 001-139; ICD10: A00-B99] | |||||
Myasthenia gravis [ICD9: 358; ICD10: G70.0] | |||||
Myasthenia gravis diagnosis [ICD9: 358; ICD10: G70.0] | |||||
Neurodegenerative disease [ICD9: 330-337; ICD10: G30-G32] | |||||
Open-angle glaucoma; Anxiety disorder [ICD9:365, 300, 311; ICD10: H40-H42, F32, F40-F42] | |||||
Pediculus humanus capitis [ICD9: 132; ICD10: B85.0] | |||||
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
Poisoning due to pesticides and chemicals [ICD10: T36-T50] | |||||
Poison intoxication [ICD10: T36-T50] | |||||
Parkinson's disease [ICD9: 332; ICD10: G20] | |||||
Urinary dysfunction [ICD10: N39.3-N39.4] | |||||
Upper abdominal bloating; Early satiation associated with functional dyspepsia [ICD9: 536.8; ICD10: K30] | |||||
Xerostomia [ICD9: 527.7; ICD10: K11.7, R68.2] | |||||
Unspecified [ICD code not available] | |||||
Function |
Rapidly hydrolyzes choline released into the synapse.
|
||||
BioChemical Class |
Carboxylic ester hydrolase
|
||||
Target Validation |
T30082
|
||||
UniProt ID | |||||
EC Number |
EC 3.1.1.7
|
||||
Sequence |
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPV
SAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPN RELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASV GMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL VACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVG VVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGY EIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQ YVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN QFDHYSKQDRCSDL |
||||
Drugs and Mode of Action | |||||
Drug(s) | Ambenonium | Drug Info | Approved | Myasthenia gravis | [538427] |
Demecarium bromide | Drug Info | Approved | Open-angle glaucoma; Anxiety disorder | [538451], [551871] | |
Donepezil | Drug Info | Approved | Alzheimer disease | [541717], [544878], [551871] | |
Echothiophate Iodide | Drug Info | Approved | Chronic glaucoma | [538454] | |
Edrophonium | Drug Info | Approved | Myasthenia gravis diagnosis | [538168] | |
Galantamine | Drug Info | Approved | Alzheimer disease | [536285], [541798] | |
Huperzine A | Drug Info | Approved | Epileptic seizures; Alzheimer disease | [544707], [551871] | |
Isoflurophate | Drug Info | Approved | Glaucoma | [536300] | |
Malathion | Drug Info | Approved | Pediculus humanus capitis | [538333] | |
Neostigmine | Drug Info | Approved | Myasthenia gravis | [550269] | |
Pralidoxime Chloride | Drug Info | Approved | Poisoning due to pesticides and chemicals | [551871] | |
Pyridostigmine | Drug Info | Approved | Myasthenia gravis | [538182] | |
Rivastigmine | Drug Info | Approved | Alzheimer disease | [522744], [541722] | |
Tacrine | Drug Info | Approved | Alzheimer disease | [536361], [541792] | |
YM443 | Drug Info | Approved | Upper abdominal bloating; Early satiation associated with functional dyspepsia | [551871] | |
(-)-Phenserine | Drug Info | Phase 3 | Alzheimer disease | [532220] | |
Amocarzine | Drug Info | Phase 3 | Helminth infection | [534433] | |
Eptastigmine | Drug Info | Phase 3 | Cognitive disorders | [526265] | |
INM-176 | Drug Info | Phase 3 | Alzheimer disease | [523260] | |
Suronacrine maleate | Drug Info | Phase 3 | Cognitive disorders | [551848] | |
Ladostigil | Drug Info | Phase 2 | Alzheimer disease | [531772] | |
Methanesulfonyl fluoride | Drug Info | Phase 2 | Alzheimer disease | [549186] | |
R-phenserine | Drug Info | Phase 2 | Alzheimer disease; Mild cognitive impairment | [548049] | |
T-82 | Drug Info | Phase 2 | Cognitive disorders | [526578] | |
Desoxypeganine | Drug Info | Phase 1 | Alcohol use disorders | [529540] | |
KW-5092 | Drug Info | Phase 1 | Pain | [534378] | |
PRX-105 | Drug Info | Phase 1 | Poison intoxication | [522989] | |
ZT-1 | Drug Info | Phase 1 | Parkinson's disease | [532328] | |
PHENSERINE TARTRATE | Drug Info | Preclinical | Parkinson's disease | [547033] | |
SPH-1285 | Drug Info | Preclinical | Alzheimer disease | [547351] | |
VELNACRINE | Drug Info | Discontinued in Phase 3 | Cognitive disorders | [527051] | |
Zanapezil | Drug Info | Discontinued in Phase 3 | Alzheimer disease | [545741] | |
Caracemide | Drug Info | Discontinued in Phase 2 | Cancer | [544726] | |
HP-290 | Drug Info | Discontinued in Phase 2 | Parkinson's disease | [546136] | |
Icopezil maleate | Drug Info | Discontinued in Phase 2 | Cognitive disorders | [546140] | |
Physostigmine | Drug Info | Discontinued in Phase 2 | Xerostomia | [541716], [548786] | |
S-9977 | Drug Info | Discontinued in Phase 2 | Cognitive disorders | [544962] | |
SM-10888 | Drug Info | Discontinued in Phase 2 | Cognitive disorders | [544850] | |
TAK-802 | Drug Info | Discontinued in Phase 2 | Urinary dysfunction | [547886] | |
ZIFROSILONE | Drug Info | Discontinued in Phase 2 | Cognitive disorders | [545006] | |
NP-61 | Drug Info | Discontinued in Phase 1 | Alzheimer disease | [548783] | |
7-methoxytacrine | Drug Info | Terminated | Discovery agent | [545830] | |
ABS-301 | Drug Info | Terminated | Alzheimer disease | [546251] | |
CI-1002 | Drug Info | Terminated | Alzheimer disease | [533784] | |
F-3796 | Drug Info | Terminated | Alzheimer disease | [545742] | |
FR-152558 | Drug Info | Terminated | Alzheimer disease | [546174] | |
MF-8615 | Drug Info | Terminated | Alzheimer disease | [546215] | |
MF268 | Drug Info | Terminated | Alzheimer disease | [546262] | |
NP-7557 | Drug Info | Terminated | Alzheimer disease | [547586] | |
Ro-46-5934 | Drug Info | Terminated | Alzheimer disease | [533753] | |
Inhibitor | (+/-)-huprineY hydrochloride | Drug Info | [528570] | ||
(-)-huperzine B | Drug Info | [529473] | |||
(-)-Phenserine | Drug Info | [551218] | |||
(-)-Tolserine | Drug Info | [551218] | |||
(1R)-1,2,2-TRIMETHYLPROPYL (S)-METHYLPHOSPHINATE | Drug Info | [551374] | |||
(2-Butyryloxy-ethyl)-trimethyl-ammonium iodide | Drug Info | [534296] | |||
(2-Chloro-ethyl)-trimethyl-ammonium chloride | Drug Info | [534296] | |||
(2-Ethoxy-ethyl)-trimethyl-ammonium iodide | Drug Info | [534296] | |||
(2-Mercapto-ethyl)-trimethyl-ammonium iodide | Drug Info | [534296] | |||
(24S)-ethylcholesta-7,9(11),22(E)-triene-3b-ol | Drug Info | [527846] | |||
(3-Bromo-propyl)-trimethyl-ammonium | Drug Info | [534296] | |||
(3-Hydroxy-2-methyl-phenyl)-trimethyl-ammonium | Drug Info | [534296] | |||
(3R)-9-amino-3-methyl-1,2,3,4-tetrahydroacridine | Drug Info | [530551] | |||
(4-Bromo-butyl)-trimethyl-ammonium | Drug Info | [534296] | |||
(4-Iodo-butyl)-trimethyl-ammonium iodide | Drug Info | [534296] | |||
(5-Bromo-pentyl)-trimethyl-ammonium | Drug Info | [534296] | |||
(R)-tacrine(10)-hupyridone | Drug Info | [551374] | |||
(RS)-tacrine(10)-hupyridone | Drug Info | [529473] | |||
(S)-tacrine(10)-hupyridone | Drug Info | [551374] | |||
(S,S)-(-)-bis(10)-hupyridone | Drug Info | [529473] | |||
(S,S)-(-)-bis(12)-hupyridone | Drug Info | [529473] | |||
1,10-bis(pyridinium)-decane dibromide | Drug Info | [530696] | |||
1,11-bis(pyridinium)-undecane dibromide | Drug Info | [530696] | |||
1,2-Di(berberine-9-O-yl)ethane dibromide | Drug Info | [530920] | |||
1,2-NAPHTHOQUINONE | Drug Info | [529103] | |||
1,3-Bis-(3-imidazolidin-2-yl-phenyl)-urea | Drug Info | [527214] | |||
1,3-Di(berberine-9-O-yl)ethane dibromide | Drug Info | [530920] | |||
1,4-Di(berberine-9-O-yl)ethane dibromide | Drug Info | [530920] | |||
1,9-bis(pyridinium)-nonane dibromide | Drug Info | [530696] | |||
1-(3-Bromomethyl-phenyl)-2,2,2-trifluoro-ethanone | Drug Info | [526149] | |||
1-benzene sulfonyl-cis-2,6-dimethyl piperidine | Drug Info | [530187] | |||
1-Deoxy-1-Thio-Heptaethylene Glycol | Drug Info | [551374] | |||
1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE | Drug Info | [551374] | |||
10-Hydroxy-infractopicrin | Drug Info | [530743] | |||
2,3-dihydropyrrolo[2,1-b]quinazolin-9(1H)-imine | Drug Info | [528402] | |||
2-(Acetylamino)-2-Deoxy-a-D-Glucopyranose | Drug Info | [551393] | |||
2-(N-Morpholino)-Ethanesulfonic Acid | Drug Info | [551393] | |||
2-Hex-5-enyl-5-non-8-enyl-3,4-dihydro-2H-pyrrole | Drug Info | [551277] | |||
2-Hex-5-enyl-5-non-8-enyl-pyrrolidine | Drug Info | [551277] | |||
2-Hex-5-enyl-5-nonyl-pyrrolidine | Drug Info | [551277] | |||
2-morpholino-N-phenethylpyrimidin-4-amine | Drug Info | [530923] | |||
2-Propyl-beta-carboline-2-ium iodide | Drug Info | [530824] | |||
24-ethyl-cholest-7-ene-3,5,6-triol | Drug Info | [527846] | |||
24-ethylcholest-6-ene-3,5-diol | Drug Info | [527846] | |||
3,4,5,6-Tetrachloro-[1,2]benzoquinone | Drug Info | [527510] | |||
3,6,9,12,15-Pentaoxaheptadecane | Drug Info | [551374] | |||
3,7-BIS(DIMETHYLAMINO)PHENOTHIAZIN-5-IUM | Drug Info | [551374] | |||
3-(2,5-Dioxo-pyrrolidin-1-yl)-benzoic acid | Drug Info | [526619] | |||
3-(2-Diethylamino-acetamino)-rutaecarpine | Drug Info | [530639] | |||
3-(2-Diethylamino-propionamino)-rutaecarpine | Drug Info | [530639] | |||
3-(2-N-Piperidyl-acetamino)-rutaecarpine | Drug Info | [530639] | |||
3-(2-N-Piperidyl-propionamino)-rutaecarpine | Drug Info | [530639] | |||
3-(2-N-Pyrrolyl-acetamino)-rutaecarpine | Drug Info | [530639] | |||
3-(2-N-Pyrrolyl-propionamino)-rutaecarpine | Drug Info | [530639] | |||
3-(3-Carboxy-propionylamino)-benzoic acid | Drug Info | [526619] | |||
3-(4-Benzoylpiperazine-1-carbonyl)coumarin | Drug Info | [529641] | |||
3-(4-o-Tolylpiperazine-1-carbonyl)coumarin | Drug Info | [529641] | |||
3-(4-Phenylpiperazin-1-carbonyl)coumarin | Drug Info | [529641] | |||
3-(dimethylamino)phenyl phenylcarbamate | Drug Info | [551218] | |||
3-hydroxy-N,N,N-trimethylbenzenaminium iodide | Drug Info | [529567] | |||
3-[(1s)-1-(Dimethylamino)Ethyl]Phenol | Drug Info | [551374] | |||
3-[2-(1-Benzyl-piperidin-4-yl)-ethyl]-1H-indazole | Drug Info | [527249] | |||
3-[3-(benzylmethylamino)propoxy]xanthen-9-one | Drug Info | [528456] | |||
3-[4-(benzylmethylamino)butoxy]xanthen-9-one | Drug Info | [528456] | |||
3-[5-(benzylmethylamino)pentyloxy]xanthen-9-one | Drug Info | [528456] | |||
3-[6-(benzylmethylamino)hexyloxy]xanthen-9-one | Drug Info | [528456] | |||
3-[7-(benzylmethylamino)-heptyloxy]xanthen-9-one | Drug Info | [528456] | |||
3-[8-(benzylmethylamino)octyloxy]xanthen-9-one | Drug Info | [528456] | |||
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [531079] | |||
4-formylphenyl-O-beta-D-ribopyranoside | Drug Info | [528897] | |||
4-formylphenyl-O-beta-Dglucopyranoside | Drug Info | [528897] | |||
4-ISOPROPYLPHENSERINE | Drug Info | [530692] | |||
4-[4-(benzhydryloxy)piperidino]butyl benzoate | Drug Info | [528979] | |||
4ALPHA-(HYDROXYMETHYL)-4ALPHA-DEMETHYLTERRITREM B | Drug Info | [534457] | |||
5,6-dinitroacenaphthoquinone | Drug Info | [529103] | |||
5-Chloro-1,2,3,4-tetrahydro-acridin-9-ylamine | Drug Info | [551237] | |||
5-Hex-5-enyl-2-nonyl-3,4-dihydro-2H-pyrrole | Drug Info | [551277] | |||
6,8-Dichloro-1,2,3,4-tetrahydro-acridin-9-ylamine | Drug Info | [526093] | |||
6-chlorotacrine hydrochloride | Drug Info | [530301] | |||
6-hydroxy-1,2,9-trimethyl-9H-beta-carbolin-2-ium | Drug Info | [528415] | |||
6-hydroxy-1,2-dimethyl-9H-beta-carbolin-2-ium | Drug Info | [528415] | |||
6-hydroxy-2,9-dimethyl-9H-beta-carbolin-2-ium | Drug Info | [528415] | |||
6-hydroxy-2-methyl-9H-beta-carbolin-2-ium | Drug Info | [528415] | |||
6-methoxy-1,2-dimethyl-9H-beta-carbolin-2-ium | Drug Info | [528415] | |||
6-methoxy-1,9-dimethyl-9H-pyrido[3,4-b]indole | Drug Info | [528415] | |||
6-methoxy-2,9-dimethyl-9H-beta-carbolin-2-ium | Drug Info | [528415] | |||
6-methoxy-2-methyl-9H-beta-carbolin-2-ium | Drug Info | [528415] | |||
6-Methyl-4-(4-benzoylpiperazin-1-yl)coumarin | Drug Info | [529641] | |||
6-Methyl-4-(4-o-tolylpiperazin-1-yl)coumarin | Drug Info | [529641] | |||
6-Methyl-4-(4-phenylpiperazin-1-yl)coumarin | Drug Info | [529641] | |||
7-Chloro-1,2,3,4-tetrahydro-acridin-9-ylamine | Drug Info | [551237] | |||
7-methoxytacrine | Drug Info | [531150] | |||
7-Oxo-7H-dibenzo[de,g]quinoline | Drug Info | [529985] | |||
8-Chloro-1,2,3,4-tetrahydro-acridin-9-ylamine | Drug Info | [551237] | |||
9-Amino-1,2,3,4-tetrahydro-acridine-1,7-diol | Drug Info | [551238] | |||
9-amino-7H-dibenzo[de,h]quinolin-7-one | Drug Info | [529985] | |||
9-Ethyl-2-methyl-beta-carboline-2-ium iodide | Drug Info | [530824] | |||
9-Ethyl-beta-carboline | Drug Info | [530824] | |||
9-hydrazino-1,2,3,4-tetrahydroacridine | Drug Info | [528564] | |||
9-O-[2-(Phenylol-1-yloxy)ethyl]berberine bromide | Drug Info | [530625] | |||
9-O-[2-(Phenylol-1-yloxy)hexyl]berberine bromide | Drug Info | [530625] | |||
9-O-[3-(2-Pyridinoxyl)butyl]-berberine bromide | Drug Info | [530920] | |||
9-O-[3-(4-Bromo-phenoxyl)butyl]-berberine bromide | Drug Info | [530920] | |||
9-O-[3-(4-Nitro-phenoxyl)butyl]-berberine bromide | Drug Info | [530920] | |||
9-O-[3-(Phenylamino)propyl]-berberine bromide | Drug Info | [530920] | |||
9-O-[3-(Phenylol-1-yloxy)propyl]berberine bromide | Drug Info | [530625] | |||
9-O-[4-(Phenylol-1-yloxy)butyl]berberine bromide | Drug Info | [530625] | |||
9-O-[5-(Phenylol-1-yloxy)pentyl]berberine bromide | Drug Info | [530625] | |||
Alkylene Linked Bis-Galanthamine derivative | Drug Info | [525746] | |||
Allyl-trimethyl-ammonium | Drug Info | [534296] | |||
Ambenonium | Drug Info | [536540] | |||
Amocarzine | Drug Info | [526781] | |||
AP-2238 | Drug Info | [530741] | |||
AP-2243 | Drug Info | [529149] | |||
BENZOQUINONE | Drug Info | [527510] | |||
Beta-L-fucose | Drug Info | [551391] | |||
BIS(12)-HUPERZINE B | Drug Info | [527419] | |||
Bis(14)-Huperzine B | Drug Info | [527419] | |||
BIS(16)-HUPERZINE B | Drug Info | [527419] | |||
BIS(18)-HUPERZINE B | Drug Info | [527419] | |||
BIS(20)-HUPERZINE B | Drug Info | [527419] | |||
BIS(8)-HUPERZINE B | Drug Info | [527419] | |||
BIS(9)-HUPERZINE B | Drug Info | [527419] | |||
Bis-7-tacrine | Drug Info | [530923] | |||
But-3-enyl-trimethyl-ammonium bromide | Drug Info | [534296] | |||
BW-28C51 | Drug Info | [529716] | |||
BW284C51 | Drug Info | [526592] | |||
BZYX | Drug Info | [543634] | |||
CAPROCTAMINE | Drug Info | [529775] | |||
Caracemide | Drug Info | [533460] | |||
Carinatumins B (2) | Drug Info | [528591] | |||
CHF-2819 | Drug Info | [528371] | |||
CHLORANIL | Drug Info | [527510] | |||
Chlorphrifos oxon | Drug Info | [529440] | |||
CHLORPYRIFOS | Drug Info | [527865] | |||
CHOLINE IODIDE | Drug Info | [534296] | |||
Cis-2,6-dimethyl-1-methyl sulfonyl piperidine | Drug Info | [530187] | |||
CLEBOPRIDE | Drug Info | [527214] | |||
CORONARIDINE | Drug Info | [531166] | |||
CRYPTADINE B | Drug Info | [529072] | |||
DECIDIUM | Drug Info | [529473] | |||
Demecarium bromide | Drug Info | [535708], [537819] | |||
Dimethyl-pent-4-enyl-ammonium bromide | Drug Info | [534296] | |||
Edrophonium | Drug Info | [537001], [537124], [537383] | |||
Eptastigmine | Drug Info | [526265] | |||
Ethyl octylfluorophosphonate | Drug Info | [529440] | |||
ETHYLPHENSERINE | Drug Info | [531080] | |||
F-3796 | Drug Info | [545743] | |||
FR-152558 | Drug Info | [546175] | |||
Fucose | Drug Info | [551393] | |||
Galantamine | Drug Info | [537334], [537340], [537434] | |||
Galanthamine derivative | Drug Info | [529473] | |||
GANSTIGMINE | Drug Info | [529473] | |||
GENESERINE | Drug Info | [528371] | |||
HALOXYSTEROL A | Drug Info | [527846] | |||
HALOXYSTEROL B | Drug Info | [527846] | |||
Haloxysterol C | Drug Info | [527846] | |||
Haloxysterol D | Drug Info | [527846] | |||
HEPTYPHYSOSTIGMINE | Drug Info | [531080] | |||
Hexyl-trimethyl-ammonium | Drug Info | [534296] | |||
HP-290 | Drug Info | [525471] | |||
Huperaine A | Drug Info | [551374] | |||
Huperzine A | Drug Info | [535553] | |||
Huprine X | Drug Info | [529473] | |||
Huprine Y | Drug Info | [530171] | |||
Huprine-Tacrine Heterodimer | Drug Info | [527471] | |||
Icopezil maleate | Drug Info | [527249] | |||
INFRACTOPICRIN | Drug Info | [530743] | |||
INM-176 | Drug Info | [531983] | |||
Iso-OMPA | Drug Info | [529716] | |||
Isoflurophate | Drug Info | [535756] | |||
Isopropyl dodecylfluorophosphonate | Drug Info | [529440] | |||
Isosorbide-2-(methylcarbamate)-5-benzoate | Drug Info | [529716] | |||
Isosorbide-2-(methylcarbamate)-5-mononitrate | Drug Info | [529716] | |||
Isosorbide-2-benzylcarbamate-5-cyclopentanoate | Drug Info | [529716] | |||
Isosorbide-2-benzylcarbamate-5-cyclopropanoate | Drug Info | [529716] | |||
Isosorbide-2-benzylcarbamate-5-tosylate | Drug Info | [529716] | |||
Isosorbide-di-(4-nitrophenyl carbamate) | Drug Info | [530646] | |||
Isosorbide-di-(benzylcarbamate) | Drug Info | [530646] | |||
Isosorbide-di-(ethylcarbamate) | Drug Info | [530646] | |||
Isosorbide-di-phenylcarbamate | Drug Info | [530646] | |||
KW-5092 | Drug Info | [534378] | |||
Ladostigil | Drug Info | [531772] | |||
LAWSARITOL | Drug Info | [527846] | |||
LIPOCRINE | Drug Info | [530437] | |||
LYSICAMINE | Drug Info | [551369] | |||
Malathion | Drug Info | [537332] | |||
MEMOQUIN | Drug Info | [530437] | |||
MESUAGENIN A | Drug Info | [531213] | |||
MESUAGENIN B | Drug Info | [531213] | |||
Mesuagenin D | Drug Info | [531213] | |||
Methanesulfonyl fluoride | Drug Info | [532098] | |||
Methyl Phosphinic Acid | Drug Info | [551393] | |||
Methylphosphonic Acid Ester Group | Drug Info | [551393] | |||
MF-8615 | Drug Info | [546216] | |||
MF268 | Drug Info | [551374] | |||
Monoisopropylphosphorylserine | Drug Info | [551393] | |||
N,N'-(1',10'-decylene)-bis-(-)-nor-MEP | Drug Info | [529368] | |||
N,N'-(1',11'-undecydene)-bis-(-)-nor-MEP | Drug Info | [529368] | |||
N,N'-(1',12'-dodecydene)-bis-(-)-nor-MEP | Drug Info | [529368] | |||
N,N'-(1',5'-pentylene)-bis-(-)-nor-MEP | Drug Info | [529368] | |||
N,N'-(1',6-hexylene)-bis-(-)-nor-MEP | Drug Info | [529368] | |||
N,N'-(1',7'-heptylene)-bis-(-)-nor-MEP | Drug Info | [529368] | |||
N,N'-(1',8'-octylene)-bis-(-)-nor-MEP | Drug Info | [529368] | |||
N,N'-(1',9'-nonylene)-bis-(-)-nor-MEP | Drug Info | [529368] | |||
N-(14-methylallyl)norgalanthamine | Drug Info | [529384] | |||
N-ALLYLNORGALANTHAMINE | Drug Info | [529384] | |||
N-allylnorlitebamine | Drug Info | [534555] | |||
N-benzyl-2-(pyrrolidin-1-yl)pyrimidin-4-amine | Drug Info | [530923] | |||
N-benzyl-2-morpholinopyrimidin-4-amine | Drug Info | [530923] | |||
N-benzyl-2-thiomorpholinopyrimidin-4-amine | Drug Info | [530923] | |||
N-benzylnorlitebamine | Drug Info | [534555] | |||
N-butylnorlitebamine | Drug Info | [534555] | |||
N-isobutylnorlitebamine | Drug Info | [534555] | |||
N-isopropylnorlitebamine | Drug Info | [534555] | |||
N-isopropylnorlitebamineN-methoiodide | Drug Info | [534555] | |||
N-Methyl-1'H-phenothiazine-1'-carboxamide | Drug Info | [530749] | |||
N-n-dodecyl-7-methoxytacrine hydrochloride | Drug Info | [531150] | |||
N-n-heptyl-7-methoxytacrine hydrochloride | Drug Info | [531150] | |||
N-n-hexyl-7-methoxytacrine hydrochloride | Drug Info | [531150] | |||
N-n-nonyl-7-methoxytacrine hydrochloride | Drug Info | [531150] | |||
N-n-octyl-7-methoxytacrine hydrochloride | Drug Info | [531150] | |||
N-n-pentyl-7-methoxytacrine hydrochloride | Drug Info | [531150] | |||
N-n-propyl-7-methoxytacrine hydrochloride | Drug Info | [531150] | |||
N-phenethyl-2-(pyrrolidin-1-yl)pyrimidin-4-amine | Drug Info | [530923] | |||
N-propylnorlitebamine | Drug Info | [534555] | |||
Neostigmine | Drug Info | [537124], [537383] | |||
NP-61 | Drug Info | [525350] | |||
NP-7557 | Drug Info | [547587] | |||
NSC-23180 | Drug Info | [529103] | |||
OBIDOXIME | Drug Info | [527865] | |||
PARAOXON | Drug Info | [529440] | |||
Petrosamine | Drug Info | [529521] | |||
PHENSERINE TARTRATE | Drug Info | [527603], [551871] | |||
Physostigmine | Drug Info | [533483] | |||
Propidium | Drug Info | [551393] | |||
PRX-105 | Drug Info | [533264] | |||
Pseudocolumbamine trifluoroacetate | Drug Info | [551369] | |||
Pseudopalmatine trifluoroacetate | Drug Info | [551369] | |||
Pyridostigmine | Drug Info | [537124] | |||
QUILOSTIGMINE | Drug Info | [531080] | |||
R-phenserine | Drug Info | [527603] | |||
Ro-46-5934 | Drug Info | [533753] | |||
S-9977 | Drug Info | [526803] | |||
SM-10888 | Drug Info | [532426] | |||
SPH-1285 | Drug Info | [525994] | |||
T-82 | Drug Info | [526578], [551871] | |||
Tacrine | Drug Info | [535519] | |||
TACRINE(8)-4-AMINOQUINOLINE | Drug Info | [551374] | |||
TAK-802 | Drug Info | [526952] | |||
TASPINE | Drug Info | [528444] | |||
TERRITREM B | Drug Info | [551363] | |||
Tetraethylene Glycol | Drug Info | [551393] | |||
THIOCTIC ACID | Drug Info | [529250] | |||
TOLSERINE | Drug Info | [531080] | |||
TRIMEDOXIME | Drug Info | [527865] | |||
Trimethyl-(3-nitro-phenyl)-ammonium iodide | Drug Info | [534296] | |||
Trimethyl-(4-oxo-pentyl)-ammonium iodide | Drug Info | [534296] | |||
TURBINATINE | Drug Info | [527312] | |||
VELNACRINE | Drug Info | [551238] | |||
VOACANGINE | Drug Info | [531166] | |||
XANTHOSTIGMINE | Drug Info | [534716] | |||
Zanapezil | Drug Info | [527590] | |||
ZIFROSILONE | Drug Info | [533665], [551871] | |||
ZT-1 | Drug Info | [527018], [551871] | |||
Modulator | ABS-301 | Drug Info | [534501] | ||
CI-1002 | Drug Info | [533784] | |||
CP-126998 | Drug Info | ||||
Desoxypeganine | Drug Info | [529540] | |||
Donepezil | Drug Info | [543634] | |||
Echothiophate Iodide | Drug Info | [556264] | |||
NPRx-30 | Drug Info | [543634] | |||
Pralidoxime Chloride | Drug Info | [556264] | |||
Rivastigmine | Drug Info | [543634] | |||
Suronacrine maleate | Drug Info | ||||
YM443 | Drug Info | [551871] | |||
Activator | MMB-4 | Drug Info | [543634] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Glycerophospholipid metabolism | ||||
Cholinergic synapse | |||||
PANTHER Pathway | Muscarinic acetylcholine receptor 1 and 3 signaling pathway | ||||
Muscarinic acetylcholine receptor 2 and 4 signaling pathway | |||||
Nicotinic acetylcholine receptor signaling pathway | |||||
Pathway Interaction Database | ATF-2 transcription factor network | ||||
PathWhiz Pathway | Phospholipid Biosynthesis | ||||
WikiPathways | Monoamine Transport | ||||
Biogenic Amine Synthesis | |||||
Acetylcholine Synthesis | |||||
Integrated Pancreatic Cancer Pathway | |||||
References | |||||
Ref 522744 | ClinicalTrials.gov (NCT00948766) Effects of Rivastigmine Patch on Activities of Daily Living and Cognition in Patients With Severe Dementia of the Alzheimer's Type (ACTION) (Study Protocol CENA713DUS44, NCT00948766) and a 24 Week Open-label Extension to Study CENA713DUS44. U.S. National Institutes of Health. | ||||
Ref 522989 | ClinicalTrials.gov (NCT01093859) An Exploratory Phase 1 Microdose Study of PRX-105. U.S. National Institutes of Health. | ||||
Ref 523260 | ClinicalTrials.gov (NCT01245530) An Efficacy and Safety Study of INM-176 for the Treatment of Patients With Alzheimer Type Dementia. U.S. National Institutes of Health. | ||||
Ref 526265 | Eptastigmine: ten years of pharmacology, toxicology, pharmacokinetic, and clinical studies. CNS Drug Rev. 2001 Winter;7(4):369-86. | ||||
Ref 526578 | Effects of T-82, a novel acetylcholinesterase inhibitor, on impaired learning and memory in passive avoidance task in rats. Eur J Pharmacol. 2003 Mar 28;465(1-2):97-103. | ||||
Ref 529540 | Phase I clinical trial with desoxypeganine, a new cholinesterase and selective MAO-A inhibitor: tolerance and pharmacokinetics study of escalating single oral doses. Methods Find Exp Clin Pharmacol. 2008 Mar;30(2):141-7. | ||||
Ref 531772 | Ladostigil: a novel multimodal neuroprotective drug with cholinesterase and brain-selective monoamine oxidase inhibitory activities for Alzheimer's disease treatment. Curr Drug Targets. 2012 Apr;13(4):483-94. | ||||
Ref 532220 | Neurotrophic and neuroprotective actions of (-)- and (+)-phenserine, candidate drugs for Alzheimer's disease. PLoS One. 2013;8(1):e54887. | ||||
Ref 532328 | Phase I study on the pharmacokinetics and tolerance of ZT-1, a prodrug of huperzine A, for the treatment of Alzheimer's disease. Acta Pharmacol Sin. 2013 Jul;34(7):976-82. | ||||
Ref 533753 | A novel acetylcholinesterase inhibitor, Ro 46-5934, which interacts with muscarinic M2 receptors. Biochem Soc Trans. 1994 Aug;22(3):755-8. | ||||
Ref 533784 | PD 142676 (CI 1002), a novel anticholinesterase and muscarinic antagonist. Mol Neurobiol. 1994 Aug-Dec;9(1-3):93-106. | ||||
Ref 534378 | Oral administration of KW-5092, a novel gastroprokinetic agent with acetylcholinesterase inhibitory and acetylcholine release enhancing activities, causes a dose-dependent increase in the blood acetylcholine content of beagle dogs. Neurosci Lett. 1997 Mar 28;225(1):25-8. | ||||
Ref 534433 | The safety and efficacy of amocarzine in African onchocerciasis and the influence of ivermectin on the clinical and parasitological response to treatment. Ann Trop Med Parasitol. 1997 Apr;91(3):281-96. | ||||
Ref 536285 | Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54. | ||||
Ref 536300 | Anaesthetic drugs: linking molecular actions to clinical effects. Curr Pharm Des. 2006;12(28):3665-79. | ||||
Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
Ref 538168 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040131. | ||||
Ref 538182 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040457. | ||||
Ref 538333 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 078743. | ||||
Ref 538427 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 010155. | ||||
Ref 538451 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011860. | ||||
Ref 538454 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011963. | ||||
Ref 541716 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6598). | ||||
Ref 541717 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6599). | ||||
Ref 541722 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6602). | ||||
Ref 541792 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6687). | ||||
Ref 541798 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6693). | ||||
Ref 544707 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000687) | ||||
Ref 544726 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000740) | ||||
Ref 544850 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001320) | ||||
Ref 544878 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001402) | ||||
Ref 544962 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001724) | ||||
Ref 545006 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001855) | ||||
Ref 545741 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004496) | ||||
Ref 545742 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004498) | ||||
Ref 545830 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004958) | ||||
Ref 546136 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006532) | ||||
Ref 546140 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006556) | ||||
Ref 546174 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006757) | ||||
Ref 546215 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006922) | ||||
Ref 546251 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007119) | ||||
Ref 546262 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007171) | ||||
Ref 547033 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012344) | ||||
Ref 547351 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015422) | ||||
Ref 547586 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017551) | ||||
Ref 547886 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020145) | ||||
Ref 548049 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021506) | ||||
Ref 548783 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028783) | ||||
Ref 548786 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028816) | ||||
Ref 549186 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033430) | ||||
Ref 525471 | NXX-066 in patients with Alzheimer's disease: a bridging study. Life Sci. 1999;64(14):1215-21. | ||||
Ref 525746 | Bioorg Med Chem Lett. 2000 Apr 3;10(7):637-9.Potent acetylcholinesterase inhibitors: design, synthesis and structure-activity relationships of alkylene linked bis-galanthamine and galanthamine-galanthaminium salts. | ||||
Ref 525994 | Galantamine, a cholinesterase inhibitor that allosterically modulates nicotinic receptors: effects on the course of Alzheimer's disease. Biol Psychiatry. 2001 Feb 1;49(3):289-99. | ||||
Ref 526093 | Bioorg Med Chem Lett. 2001 Jul 9;11(13):1779-82.Novel and potent tacrine-related hetero- and homobivalent ligands for acetylcholinesterase and butyrylcholinesterase. | ||||
Ref 526149 | J Med Chem. 2001 Sep 27;44(20):3203-15.A structure-based design approach to the development of novel, reversible AChE inhibitors. | ||||
Ref 526265 | Eptastigmine: ten years of pharmacology, toxicology, pharmacokinetic, and clinical studies. CNS Drug Rev. 2001 Winter;7(4):369-86. | ||||
Ref 526578 | Effects of T-82, a novel acetylcholinesterase inhibitor, on impaired learning and memory in passive avoidance task in rats. Eur J Pharmacol. 2003 Mar 28;465(1-2):97-103. | ||||
Ref 526592 | Cholinesterases: new roles in brain function and in Alzheimer's disease. Neurochem Res. 2003 Apr;28(3-4):515-22. | ||||
Ref 526619 | Bioorg Med Chem Lett. 2003 May 19;13(10):1825-7.Synthesis, anticholinesterase activity and structure-activity relationships of m-Aminobenzoic acid derivatives. | ||||
Ref 526781 | Activity, mechanism of action and pharmacokinetics of 2-tert-butylbenzothiazole and CGP 6140 (amocarzine) antifilarial drugs. Acta Trop. 1992 Aug;51(3-4):195-211. | ||||
Ref 526803 | Xanthine derivatives IBMX and S-9977-2 potentiate transmission at an Aplysia central cholinergic synapse. Brain Res. 1992 Jul 17;586(1):78-85. | ||||
Ref 526952 | Effects of TAK-802, a novel acetylcholinesterase inhibitor, on distension-induced rhythmic bladder contractions in rats and guinea pigs. Eur J Pharmacol. 2004 Feb 6;485(1-3):299-305. | ||||
Ref 527018 | A sensitive method for the determination of the novel cholinesterase inhibitor ZT-1 and its active metabolite huperzine A in rat blood using liquid chromatography/tandem mass spectrometry. Rapid Commun Mass Spectrom. 2004;18(6):651-6. | ||||
Ref 527214 | J Med Chem. 2004 Sep 23;47(20):4818-28.Efficient method for high-throughput virtual screening based on flexible docking: discovery of novel acetylcholinesterase inhibitors. | ||||
Ref 527249 | J Med Chem. 2004 Oct 21;47(22):5492-500.A docking score function for estimating ligand-protein interactions: application to acetylcholinesterase inhibition. | ||||
Ref 527312 | J Nat Prod. 2004 Nov;67(11):1882-5.Indole glucoalkaloids from Chimarrhis turbinata and their evaluation as antioxidant agents and acetylcholinesterase inhibitors. | ||||
Ref 527419 | J Med Chem. 2005 Feb 10;48(3):655-7.Bis-huperzine B: highly potent and selective acetylcholinesterase inhibitors. | ||||
Ref 527471 | J Med Chem. 2005 Mar 24;48(6):1701-4.Synthesis and pharmacological evaluation of huprine-tacrine heterodimers: subnanomolar dual binding site acetylcholinesterase inhibitors. | ||||
Ref 527510 | J Med Chem. 2005 Apr 21;48(8):2906-15.Identification and characterization of novel benzil (diphenylethane-1,2-dione) analogues as inhibitors of mammalian carboxylesterases. | ||||
Ref 527590 | Effect of oral administration of zanapezil (TAK-147) for 21 days on acetylcholine and monoamines levels in the ventral hippocampus of freely moving rats. Br J Pharmacol. 2005 Aug;145(8):1035-44. | ||||
Ref 527603 | An overview of phenserine tartrate, a novel acetylcholinesterase inhibitor for the treatment of Alzheimer's disease. Curr Alzheimer Res. 2005 Jul;2(3):281-90. | ||||
Ref 527846 | Bioorg Med Chem Lett. 2006 Feb;16(3):573-80. Epub 2005 Nov 7.Isolation and cholinesterase-inhibition studies of sterols from Haloxylon recurvum. | ||||
Ref 527865 | Bioorg Med Chem Lett. 2006 Feb;16(3):622-7. Epub 2005 Nov 8.Synthesis of the novel series of bispyridinium compounds bearing (E)-but-2-ene linker and evaluation of their reactivation activity against chlorpyrifos-inhibited acetylcholinesterase. | ||||
Ref 528371 | J Med Chem. 2006 Aug 24;49(17):5051-8.Structural determinants of Torpedo californica acetylcholinesterase inhibition by the novel and orally active carbamate based anti-alzheimer drug ganstigmine (CHF-2819). | ||||
Ref 528402 | J Med Chem. 2006 Sep 7;49(18):5411-3.Homobivalent quinazolinimines as novel nanomolar inhibitors of cholinesterases with dirigible selectivity toward butyrylcholinesterase. | ||||
Ref 528415 | Bioorg Med Chem Lett. 2006 Nov 15;16(22):5840-3. Epub 2006 Sep 1.6-Hydroxy- and 6-methoxy-beta-carbolines as acetyl- and butyrylcholinesterase inhibitors. | ||||
Ref 528444 | J Nat Prod. 2006 Sep;69(9):1341-6.Taspine: bioactivity-guided isolation and molecular ligand-target insight of a potent acetylcholinesterase inhibitor from Magnolia x soulangiana. | ||||
Ref 528456 | Bioorg Med Chem. 2007 Jan 1;15(1):575-85. Epub 2006 Sep 27.Cholinesterase inhibitors: SAR and enzyme inhibitory activity of 3-[omega-(benzylmethylamino)alkoxy]xanthen-9-ones. | ||||
Ref 528564 | J Med Chem. 2006 Dec 14;49(25):7540-4.Novel heterobivalent tacrine derivatives as cholinesterase inhibitors with notable selectivity toward butyrylcholinesterase. | ||||
Ref 528570 | J Med Chem. 2006 Nov 16;49(23):6833-40.Binding of 13-amidohuprines to acetylcholinesterase: exploring the ligand-induced conformational change of the gly117-gly118 peptide bond in the oxyanion hole. | ||||
Ref 528591 | Bioorg Med Chem. 2007 Feb 15;15(4):1703-7. Epub 2006 Dec 15.Carinatumins A-C, new alkaloids from Lycopodium carinatum inhibiting acetylcholinesterase. | ||||
Ref 528897 | Eur J Med Chem. 2008 Jan;43(1):166-73. Epub 2007 Apr 5.Synthesis and biological evaluation of helicid analogues as novel acetylcholinesterase inhibitors. | ||||
Ref 528979 | Bioorg Med Chem. 2007 Oct 15;15(20):6596-607. Epub 2007 Jul 25.Synthesis, in vitro assay, and molecular modeling of new piperidine derivatives having dual inhibitory potency against acetylcholinesterase and Abeta1-42 aggregation for Alzheimer's disease therapeutics. | ||||
Ref 529072 | Bioorg Med Chem. 2007 Dec 15;15(24):7803-8. Epub 2007 Aug 28.Cryptadines A and B, novel C27N3-type pentacyclic alkaloids from Lycopodium cryptomerinum. | ||||
Ref 529103 | J Med Chem. 2007 Nov 15;50(23):5727-34. Epub 2007 Oct 17.Planarity and constraint of the carbonyl groups in 1,2-diones are determinants for selective inhibition of human carboxylesterase 1. | ||||
Ref 529149 | Bioorg Med Chem Lett. 2008 Jan 1;18(1):423-6. Epub 2007 Oct 4.Multi-target-directed coumarin derivatives: hAChE and BACE1 inhibitors as potential anti-Alzheimer compounds. | ||||
Ref 529250 | J Med Chem. 2008 Feb 14;51(3):347-72. Epub 2008 Jan 9.Multi-target-directed ligands to combat neurodegenerative diseases. | ||||
Ref 529368 | J Med Chem. 2008 Apr 10;51(7):2027-36. Epub 2008 Mar 12.Bis-(-)-nor-meptazinols as novel nanomolar cholinesterase inhibitors with high inhibitory potency on amyloid-beta aggregation. | ||||
Ref 529384 | Bioorg Med Chem Lett. 2008 Apr 1;18(7):2263-6. Epub 2008 Mar 7.N-Alkylated galanthamine derivatives: Potent acetylcholinesterase inhibitors from Leucojum aestivum. | ||||
Ref 529440 | Nat Chem Biol. 2008 Jun;4(6):373-8. Epub 2008 Apr 27.Activation of the endocannabinoid system by organophosphorus nerve agents. | ||||
Ref 529473 | J Med Chem. 2008 Jun 12;51(11):3154-70. Epub 2008 May 15.Exploiting protein fluctuations at the active-site gorge of human cholinesterases: further optimization of the design strategy to develop extremely potent inhibitors. | ||||
Ref 529521 | Bioorg Med Chem. 2008 Jul 1;16(13):6560-7. Epub 2008 May 15.Petrosamine, a potent anticholinesterase pyridoacridine alkaloid from a Thai marine sponge Petrosia n. sp. | ||||
Ref 529540 | Phase I clinical trial with desoxypeganine, a new cholinesterase and selective MAO-A inhibitor: tolerance and pharmacokinetics study of escalating single oral doses. Methods Find Exp Clin Pharmacol. 2008 Mar;30(2):141-7. | ||||
Ref 529567 | Bioorg Med Chem. 2008 Aug 1;16(15):7450-6. Epub 2008 Jun 14.Homo- and hetero-bivalent edrophonium-like ammonium salts as highly potent, dual binding site AChE inhibitors. | ||||
Ref 529641 | Bioorg Med Chem. 2008 Sep 1;16(17):8011-21. Epub 2008 Jul 29.Design, synthesis, and acetylcholinesterase inhibitory activity of novel coumarin analogues. | ||||
Ref 529716 | J Med Chem. 2008 Oct 23;51(20):6400-9. Epub 2008 Sep 26.Isosorbide-2-carbamate esters: potent and selective butyrylcholinesterase inhibitors. | ||||
Ref 529775 | J Med Chem. 2008 Nov 27;51(22):7308-12.Structure-activity relationships of acetylcholinesterase noncovalent inhibitors based on a polyamine backbone. 4. Further investigation on the inner spacer. | ||||
Ref 529985 | Eur J Med Chem. 2009 Jun;44(6):2523-32. Epub 2009 Jan 31.Synthesis, biological evaluation and molecular modeling of oxoisoaporphine and oxoaporphine derivatives as new dual inhibitors of acetylcholinesterase/butyrylcholinesterase. | ||||
Ref 530171 | Bioorg Med Chem. 2009 Jul 1;17(13):4523-36. Epub 2009 May 8.Synthesis and structure-activity relationship of Huprine derivatives as human acetylcholinesterase inhibitors. | ||||
Ref 530187 | Eur J Med Chem. 2009 Oct;44(10):4057-62. Epub 2009 May 8.Active site directed docking studies: synthesis and pharmacological evaluation of cis-2,6-dimethyl piperidine sulfonamides as inhibitors of acetylcholinesterase. | ||||
Ref 530301 | J Med Chem. 2009 Sep 10;52(17):5365-79.Pyrano[3,2-c]quinoline-6-chlorotacrine hybrids as a novel family of acetylcholinesterase- and beta-amyloid-directed anti-Alzheimer compounds. | ||||
Ref 530437 | J Med Chem. 2009 Dec 10;52(23):7883-6.Toward a rational design of multitarget-directed antioxidants: merging memoquin and lipoic acid molecular frameworks. | ||||
Ref 530551 | Eur J Med Chem. 2010 Feb;45(2):526-35. Epub 2009 Nov 10.Synthesis and AChE inhibitory activity of new chiral tetrahydroacridine analogues from terpenic cyclanones. | ||||
Ref 530625 | Bioorg Med Chem. 2010 Feb;18(3):1244-51. Epub 2009 Dec 16.Synthesis, biological evaluation, and molecular modeling of berberine derivatives as potent acetylcholinesterase inhibitors. | ||||
Ref 530639 | Eur J Med Chem. 2010 Apr;45(4):1415-23. Epub 2010 Jan 4.Synthesis and evaluation of novel rutaecarpine derivatives and related alkaloids derivatives as selective acetylcholinesterase inhibitors. | ||||
Ref 530646 | Bioorg Med Chem. 2010 Feb;18(3):1045-53. Epub 2010 Jan 6.Isosorbide-based cholinesterase inhibitors; replacement of 5-ester groups leading to increased stability. | ||||
Ref 530692 | Bioorg Med Chem Lett. 2010 Mar 1;20(5):1718-20. Epub 2010 Jan 20.Design, synthesis, evaluation and QSAR analysis of N(1)-substituted norcymserine derivatives as selective butyrylcholinesterase inhibitors. | ||||
Ref 530696 | Bioorg Med Chem Lett. 2010 Mar 1;20(5):1763-6. Epub 2010 Jan 20.Preparation and in vitro screening of symmetrical bispyridinium cholinesterase inhibitors bearing different connecting linkage-initialstudy for Myasthenia gravis implications. | ||||
Ref 530741 | Bioorg Med Chem. 2010 Mar 1;18(5):1749-60. Epub 2010 Feb 4.Targeting Alzheimer's disease: Novel indanone hybrids bearing a pharmacophoric fragment of AP2238. | ||||
Ref 530743 | Bioorg Med Chem. 2010 Mar 15;18(6):2173-7. Epub 2010 Feb 4.Acetylcholinesterase inhibitors from the toadstool Cortinarius infractus. | ||||
Ref 530749 | Bioorg Med Chem. 2010 Mar 15;18(6):2232-44. Epub 2010 Feb 4.Differential binding of phenothiazine urea derivatives to wild-type human cholinesterases and butyrylcholinesterase mutants. | ||||
Ref 530824 | J Med Chem. 2010 May 13;53(9):3611-7.Bivalent beta-carbolines as potential multitarget anti-Alzheimer agents. | ||||
Ref 530920 | Bioorg Med Chem. 2010 Jun 15;18(12):4475-84. Epub 2010 Apr 27.Synthesis and biological evaluation of a new series of berberine derivatives as dual inhibitors of acetylcholinesterase and butyrylcholinesterase. | ||||
Ref 530923 | Bioorg Med Chem Lett. 2010 Jun 15;20(12):3606-9. Epub 2010 Apr 28.Design, synthesis and evaluation of 2,4-disubstituted pyrimidines as cholinesterase inhibitors. | ||||
Ref 531079 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
Ref 531080 | J Med Chem. 2010 Sep 9;53(17):6490-505.Novel carbamates as orally active acetylcholinesterase inhibitors found to improve scopolamine-induced cognition impairment: pharmacophore-based virtual screening, synthesis, and pharmacology. | ||||
Ref 531150 | Bioorg Med Chem Lett. 2010 Oct 15;20(20):6093-5. Epub 2010 Aug 16.Synthesis and in vitro evaluation of N-alkyl-7-methoxytacrine hydrochlorides as potential cholinesterase inhibitors in Alzheimer disease. | ||||
Ref 531166 | Bioorg Med Chem Lett. 2010 Nov 1;20(21):6185-7. Epub 2010 Aug 31.Indole alkaloids from Ervatamia hainanensis with potent acetylcholinesterase inhibition activities. | ||||
Ref 531213 | Bioorg Med Chem. 2010 Nov 15;18(22):7873-7. Epub 2010 Sep 25.4-Phenylcoumarins from Mesua elegans with acetylcholinesterase inhibitory activity. | ||||
Ref 531772 | Ladostigil: a novel multimodal neuroprotective drug with cholinesterase and brain-selective monoamine oxidase inhibitory activities for Alzheimer's disease treatment. Curr Drug Targets. 2012 Apr;13(4):483-94. | ||||
Ref 531983 | The memory ameliorating effects of INM-176, an ethanolic extract of Angelica gigas, against scopolamine- or Abeta(1-42)-induced cognitive dysfunction in mice. J Ethnopharmacol. 2012 Sep 28;143(2):611-20. | ||||
Ref 532098 | A randomized phase I study of methanesulfonyl fluoride, an irreversible cholinesterase inhibitor, for the treatment of Alzheimer's disease. Br J Clin Pharmacol. 2013 May;75(5):1231-9. | ||||
Ref 532426 | Pharmacological and biochemical assessment of SM-10888, a novel cholinesterase inhibitor. Jpn J Pharmacol. 1990 Jun;53(2):145-55. | ||||
Ref 533264 | Preclinical and first-in-human evaluation of PRX-105, a PEGylated, plant-derived, recombinant human acetylcholinesterase-R. Toxicol Appl Pharmacol. 2015 Sep 15;287(3):202-9. | ||||
Ref 533460 | Biochemical pharmacology of N-acetyl-N-(methylcarbamoyloxy)-N'-methylurea (caracemide; NSC-253272). Biochem Pharmacol. 1986 Aug 15;35(16):2781-7. | ||||
Ref 533483 | The effects of physostigmine on acetylcholinesterase activity of CSF plasma and brain. A comparison of intravenous and intraventricular administration in beagle dogs. Neuropharmacology. 1986 Oct;25(10):1167-77. | ||||
Ref 533665 | Acetylcholinesterase inhibition by zifrosilone: pharmacokinetics and pharmacodynamics. Clin Pharmacol Ther. 1995 Jul;58(1):54-61. | ||||
Ref 533753 | A novel acetylcholinesterase inhibitor, Ro 46-5934, which interacts with muscarinic M2 receptors. Biochem Soc Trans. 1994 Aug;22(3):755-8. | ||||
Ref 533784 | PD 142676 (CI 1002), a novel anticholinesterase and muscarinic antagonist. Mol Neurobiol. 1994 Aug-Dec;9(1-3):93-106. | ||||
Ref 534296 | J Med Chem. 1996 Dec 20;39(26):5064-71.Structure-based alignment and comparative molecular field analysis of acetylcholinesterase inhibitors. | ||||
Ref 534378 | Oral administration of KW-5092, a novel gastroprokinetic agent with acetylcholinesterase inhibitory and acetylcholine release enhancing activities, causes a dose-dependent increase in the blood acetylcholine content of beagle dogs. Neurosci Lett. 1997 Mar 28;225(1):25-8. | ||||
Ref 534457 | J Nat Prod. 1997 Aug;60(8):842-3.Structure and anti-acetylcholinesterase activity of 4 alpha-(hydroxymethyl)-4 alpha-demethylterritrem B. | ||||
Ref 534501 | Novel tacrine analogues for potential use against Alzheimer's disease: potent and selective acetylcholinesterase inhibitors and 5-HT uptake inhibitors. J Med Chem. 1997 Oct 24;40(22):3516-23. | ||||
Ref 534555 | J Nat Prod. 1998 Jan;61(1):46-50.Litebamine N-homologues: preparation and anti-acetylcholinesterase activity. | ||||
Ref 534716 | J Med Chem. 1998 Oct 8;41(21):3976-86.Acetylcholinesterase inhibitors: synthesis and structure-activity relationships of omega-[N-methyl-N-(3-alkylcarbamoyloxyphenyl)- methyl]aminoalkoxyheteroaryl derivatives. | ||||
Ref 535519 | Evidence that the clinical effects of cholinesterase inhibitors are related to potency and targeting of action. Int J Clin Pract Suppl. 2002 Jun;(127):6-19. | ||||
Ref 535553 | Huperzine A attenuates cognitive deficits and brain injury in neonatal rats after hypoxia-ischemia. Brain Res. 2002 Sep 13;949(1-2):162-70. | ||||
Ref 535708 | The effects of topical ocular application of 0.25% demecarium bromide on serum acetylcholinesterase levels in normal dogs. Vet Ophthalmol. 2003 Mar;6(1):23-5. | ||||
Ref 535756 | Rational design of alkylene-linked bis-pyridiniumaldoximes as improved acetylcholinesterase reactivators. Chem Biol. 2003 Jun;10(6):491-502. | ||||
Ref 536540 | Alpha6-containing nicotinic acetylcholine receptors dominate the nicotine control of dopamine neurotransmission in nucleus accumbens. Neuropsychopharmacology. 2008 Aug;33(9):2158-66. Epub 2007 Nov 21. | ||||
Ref 537001 | Stabilization of Torpedo californica acetylcholinesterase by reversible inhibitors. Biochemistry. 2009 Jan 27;48(3):563-74. | ||||
Ref 537124 | Neuromuscular blockade, reversal agent use, and operating room time: retrospective analysis of US inpatient surgeries. Curr Med Res Opin. 2009 Apr;25(4):943-50. | ||||
Ref 537332 | Acetylcholinesterase activity in Corbicula fluminea Mull., as a biomarker of organophosphate pesticide pollution in Pinacanauan River, Philippines. Environ Monit Assess. 2009 May 12. | ||||
Ref 537334 | Effects of cholinesterase inhibition on brain white matter volume in Alzheimer's disease. Neuroreport. 2009 Feb 18;20(3):285-8. | ||||
Ref 537340 | Acetylcholinesterase inhibitors enhance cognitive functions in rats following hypobaric hypoxia. Behav Brain Res. 2009 Oct 12;203(1):1-14. Epub 2009 Mar 28. | ||||
Ref 537383 | Screening of acetylcholinesterase inhibitors by CE after enzymatic reaction at capillary inlet. J Sep Sci. 2009 May;32(10):1748-56. | ||||
Ref 537434 | From symptomatic to disease modifying therapy? Recent developments in the pharmacotherapy of Alzheimer's disease. Fortschr Neurol Psychiatr. 2009 Jun;77(6):326-33. Epub 2009 Jun 5. | ||||
Ref 537819 | Neuromuscular blocking agents and axial teratogenesis in the avian embryo. Can axial morphogenetic disorders by explained by pharmacological action upon muscle tissue? Teratology. 1981 Apr;23(2):259-71. | ||||
Ref 543634 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2465). | ||||
Ref 545743 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004498) | ||||
Ref 546175 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006757) | ||||
Ref 546216 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006922) | ||||
Ref 547587 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017551) | ||||
Ref 551218 | Long-acting anticholinesterases for myasthenia gravis: synthesis and activities of quaternary phenylcarbamates of neostigmine, pyridostigmine and physostigmine. Bioorg Med Chem. 2010 Jul 1;18(13):4687-93. doi: 10.1016/j.bmc.2010.05.022. Epub 2010 May 12. | ||||
Ref 551237 | The synthesis and in vitro acetylcholinesterase and butyrylcholinesterase inhibitory activity of tacrine (Cognex?) derivaties, Bioorg. Med. Chem. Lett. 2(8):861-864 (1992). | ||||
Ref 551238 | Synthesis and biological activity of putative mono-hydroxylated metabolites of velnacrine, Bioorg. Med. Chem. Lett. 2(8):865-870 (1992). | ||||
Ref 551277 | Acetylcholinesterase inhibition by alkaloids of the ant's venom Monomorium minutum, Bioorg. Med. Chem. Lett. 5(11):1131-1132 (1995). | ||||
Ref 551363 | Acetylcholinesterase inhibition by territrem B derivatives. J Nat Prod. 1995 Jun;58(6):857-62. | ||||
Ref 551369 | Characterization of Acetylcholinesterase Inhibitory Constituents from Annona glabra Assisted by HPLC Microfractionation. J Nat Prod. 2010 Oct 22;73(10):1632-5. doi: 10.1021/np100247r. Epub 2010 Sep 9. | ||||
Ref 551391 | DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.