Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T79062
|
||||
| Former ID |
TTDR00157
|
||||
| Target Name |
5-hydroxytryptamine 7 receptor
|
||||
| Gene Name |
HTR7
|
||||
| Synonyms |
5-HT-7; 5-HT-X; 5-HT7 receptor; 5HT7; Serotonin receptor; Serotonin receptor 7; HTR7
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32] | ||||
| Psychiatric disorder [ICD9: 290-319; ICD10: F01-F99] | |||||
| Schizophrenia [ICD9: 295; ICD10: F20] | |||||
| Sleep disorders [ICD9: 307.4, 327, 780.5; ICD10: F51, G47] | |||||
| Function |
This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T79062
|
||||
| UniProt ID | |||||
| Sequence |
MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTW
DAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLI VSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDR YLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYT IYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSC IPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK LAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD |
||||
| Drugs and Mode of Action | |||||
| Agonist | (+)-LSD | Drug Info | [534025] | ||
| 1-naphthylpiperazine | Drug Info | [533934] | |||
| 2-MPP | Drug Info | [534019] | |||
| 5-CT | Drug Info | [534022] | |||
| AS-19 | Drug Info | [532288] | |||
| bufotenine | Drug Info | [534022] | |||
| dipropyl-5-CT | Drug Info | [534463] | |||
| DM-1451 | Drug Info | [525492] | |||
| E55888 | Drug Info | [529896] | |||
| EMDT | Drug Info | [525722] | |||
| LP-12 | Drug Info | [528956] | |||
| LP-211 | Drug Info | [529703] | |||
| LP-44 | Drug Info | [528956] | |||
| m-chlorophenylpiperazine | Drug Info | [534019] | |||
| OPC 4392 | Drug Info | [525492] | |||
| TFMPP | Drug Info | [534019] | |||
| [125I]LSD | Drug Info | [534026] | |||
| [3H]5-CT | Drug Info | [525765] | |||
| [3H]5-HT | Drug Info | [533934] | |||
| [3H]LSD | Drug Info | [534474] | |||
| Inhibitor | (+/-)-nantenine | Drug Info | [530558] | ||
| (2-biphenyl-3-yl-ethyl)-dimethyl-amine | Drug Info | [528780] | |||
| (R)-8-phenyl-N,N-dipropylchroman-3-amine | Drug Info | [530699] | |||
| 1-(3-(pentafluorosulfanyl)phenyl)propan-2-amine | Drug Info | [529013] | |||
| 1-Naphthalen-1-yl-piperazine | Drug Info | [526655] | |||
| 2-(1-o-tolyl-1H-pyrrol-3-yl)ethanamine | Drug Info | [528780] | |||
| 2-(2'-methyl-biphenyl-3-yl)-ethylamine | Drug Info | [528780] | |||
| 2-(2-Bromophenoxy)-N,N-dimethylethanamine | Drug Info | [530699] | |||
| 2-(2-Bromophenylthio)-N,N-dimethylethanamine | Drug Info | [530699] | |||
| 2-(Biphenyl-2-yloxy)-N,N-dimethylethanamine | Drug Info | [530699] | |||
| 2-(Biphenyl-2-ylthio)-N,N-dimethylethanamine | Drug Info | [530699] | |||
| 2-[1-(2-Chloro-phenyl)-1H-pyrrol-2-yl]-ethylamine | Drug Info | [527627] | |||
| 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [531079] | |||
| 5,6-dichloro-3,4-dihydroquinazolin-2-amine | Drug Info | [529148] | |||
| 5-chloro-3,4-dihydroquinazolin-2-amine | Drug Info | [529148] | |||
| 5-chloro-4-ethyl-3,4-dihydroquinazolin-2-amine | Drug Info | [529148] | |||
| 5-chloro-4-methyl-3,4-dihydroquinazolin-2-amine | Drug Info | [529148] | |||
| 8-methoxy-4-methyl-3,4-dihydroquinazolin-2-amine | Drug Info | [529148] | |||
| Disulergine | Drug Info | [526655] | |||
| FALCARINDIOL | Drug Info | [528164] | |||
| IMPERATORIN | Drug Info | [528164] | |||
| MESULERGINE | Drug Info | [530041] | |||
| METHIOTHEPIN | Drug Info | [529222] | |||
| N,N-dimethyl-2-(2'-methylbiphenyl-3-yl)ethanamine | Drug Info | [530699] | |||
| P-hydroxyphenethyl trans-ferulate | Drug Info | [528164] | |||
| SB-258719 | Drug Info | [526655] | |||
| SB-258741 | Drug Info | [526655] | |||
| SB-271046 | Drug Info | [529191] | |||
| SB-656104 | Drug Info | [526655] | |||
| SEROTONIN | Drug Info | [529569] | |||
| SPIPERONE | Drug Info | [526655] | |||
| UCM-5600 | Drug Info | [530041] | |||
| WAY-208466 | Drug Info | [530209] | |||
| WAY-466 | Drug Info | [527381] | |||
| Antagonist | 2-bromo-LSD | Drug Info | [534022] | ||
| cyamemazine | Drug Info | [526510] | |||
| dihydroergocryptine | Drug Info | [534022] | |||
| DR-4004 | Drug Info | [526655] | |||
| fluperlapine | Drug Info | [533798] | |||
| JNJ-18038683 | Drug Info | [533126] | |||
| metergoline | Drug Info | [533934] | |||
| MPDT | Drug Info | [525722] | |||
| pirenperone | Drug Info | [534463] | |||
| SB 269970-A | Drug Info | [535905] | |||
| SB 656104-A | Drug Info | [535905] | |||
| [3H]SB269970 | Drug Info | [525765] | |||
| Modulator | ATI-9242 | Drug Info | [550651] | ||
| SB-269970 | Drug Info | ||||
| SEL-73 | Drug Info | [543373] | |||
| Modulator (allosteric modulator) | oleamide | Drug Info | [525635] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Ras signaling pathway | ||||
| Calcium signaling pathway | |||||
| Neuroactive ligand-receptor interaction | |||||
| Serotonergic synapse | |||||
| PANTHER Pathway | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | ||||
| PathWhiz Pathway | Excitatory Neural Signalling Through 5-HTR 7 and Serotonin | ||||
| Reactome | Serotonin receptors | ||||
| G alpha (s) signalling events | |||||
| WikiPathways | Serotonin Receptor 4/6/7 and NR3C Signaling | ||||
| Monoamine GPCRs | |||||
| GPCRs, Class A Rhodopsin-like | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| GPCRs, Other | |||||
| References | |||||
| Ref 522172 | ClinicalTrials.gov (NCT00566202) A Safety and Effectiveness Study of JNJ-18038683 in Patients With Moderate to Severe Depression. U.S. National Institutes of Health. | ||||
| Ref 540209 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3233). | ||||
| Ref 543133 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8432). | ||||
| Ref 525492 | Interactions of the novel antipsychotic aripiprazole (OPC-14597) with dopamine and serotonin receptor subtypes. Neuropsychopharmacology. 1999 Jun;20(6):612-27. | ||||
| Ref 525635 | Allosteric regulation by oleamide of the binding properties of 5-hydroxytryptamine7 receptors. Biochem Pharmacol. 1999 Dec 1;58(11):1807-13. | ||||
| Ref 525722 | 2-Substituted tryptamines: agents with selectivity for 5-HT(6) serotonin receptors. J Med Chem. 2000 Mar 9;43(5):1011-8. | ||||
| Ref 525765 | [(3)H]-SB-269970--A selective antagonist radioligand for 5-HT(7) receptors. Br J Pharmacol. 2000 May;130(2):409-17. | ||||
| Ref 526510 | Affinity of cyamemazine, an anxiolytic antipsychotic drug, for human recombinant dopamine vs. serotonin receptor subtypes. Biochem Pharmacol. 2003 Feb 1;65(3):435-40. | ||||
| Ref 526655 | J Med Chem. 2003 Jul 3;46(14):2795-812.Higher-end serotonin receptors: 5-HT(5), 5-HT(6), and 5-HT(7). | ||||
| Ref 527381 | J Med Chem. 2005 Jan 27;48(2):353-6.Discovery of 5-arylsulfonamido-3-(pyrrolidin-2-ylmethyl)-1H-indole derivatives as potent, selective 5-HT6 receptor agonists and antagonists. | ||||
| Ref 527627 | Bioorg Med Chem Lett. 2005 Aug 15;15(16):3753-7.Phenylpyrroles, a new chemolibrary virtual screening class of 5-HT7 receptor ligands. | ||||
| Ref 528164 | J Nat Prod. 2006 Apr;69(4):536-41.Serotonergic activity-guided phytochemical investigation of the roots of Angelica sinensis. | ||||
| Ref 528780 | Bioorg Med Chem Lett. 2007 Jun 1;17(11):3018-22. Epub 2007 Mar 23.Novel aminoethylbiphenyls as 5-HT7 receptor ligands. | ||||
| Ref 528956 | Structure-activity relationship study on N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides, a class of 5-HT7 receptor agents. 2. J Med Chem. 2007 Aug 23;50(17):4214-21. Epub 2007 Jul 25. | ||||
| Ref 529013 | Bioorg Med Chem. 2007 Nov 1;15(21):6659-66. Epub 2007 Aug 15.The synthesis and biological activity of pentafluorosulfanyl analogs of fluoxetine, fenfluramine, and norfenfluramine. | ||||
| Ref 529148 | Bioorg Med Chem Lett. 2008 Jan 1;18(1):256-61. Epub 2007 Oct 30.Cyclic guanidines as dual 5-HT5A/5-HT7 receptor ligands: structure-activity relationship elucidation. | ||||
| Ref 529191 | Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43. Epub 2007 Nov 17.Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. | ||||
| Ref 529222 | Bioorg Med Chem. 2008 Mar 1;16(5):2570-8. Epub 2007 Nov 22.Novel quinazolinone derivatives as 5-HT7 receptor ligands. | ||||
| Ref 529569 | J Med Chem. 2008 Jul 24;51(14):4150-69. Epub 2008 Jun 28.Identification of a potent, selective, and orally active leukotriene a4 hydrolase inhibitor with anti-inflammatory activity. | ||||
| Ref 529703 | J Med Chem. 2008 Sep 25;51(18):5813-22.Structural modifications of N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides: influence on lipophilicity and 5-HT7 receptor activity. Part III. | ||||
| Ref 529896 | 5-HT7 receptor activation inhibits mechanical hypersensitivity secondary to capsaicin sensitization in mice. Pain. 2009 Feb;141(3):239-47. | ||||
| Ref 530041 | J Med Chem. 2009 Apr 23;52(8):2384-92.Synthesis of new serotonin 5-HT7 receptor ligands. Determinants of 5-HT7/5-HT1A receptor selectivity. | ||||
| Ref 530209 | Bioorg Med Chem. 2009 Jul 15;17(14):5153-63. Epub 2009 May 29.Novel 1-aminoethyl-3-arylsulfonyl-1H-pyrrolo[2,3-b]pyridines are potent 5-HT(6) agonists. | ||||
| Ref 530558 | Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. | ||||
| Ref 530699 | Bioorg Med Chem. 2010 Mar 1;18(5):1958-67. Epub 2010 Jan 18.SAR studies on new bis-aryls 5-HT7 ligands: Synthesis and molecular modeling. | ||||
| Ref 531079 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
| Ref 532288 | Discovery of aryl-biphenyl-2-ylmethylpiperazines as novel scaffolds for 5-HT(7) ligands and role of the aromatic substituents in binding to the target receptor. Bioorg Med Chem. 2013 May 1;21(9):2568-76. | ||||
| Ref 533126 | Selective pharmacological blockade of the 5-HT7 receptor attenuates light and 8-OH-DPAT induced phase shifts of mouse circadian wheel running activity. Front Behav Neurosci. 2015 Jan 15;8:453. | ||||
| Ref 533798 | Binding of typical and atypical antipsychotic agents to 5-hydroxytryptamine-6 and 5-hydroxytryptamine-7 receptors. J Pharmacol Exp Ther. 1994 Mar;268(3):1403-10. | ||||
| Ref 533934 | Cloning of a novel human serotonin receptor (5-HT7) positively linked to adenylate cyclase. J Biol Chem. 1993 Nov 5;268(31):23422-6. | ||||
| Ref 534019 | Molecular cloning and expression of a 5-hydroxytryptamine7 serotonin receptor subtype. J Biol Chem. 1993 Aug 25;268(24):18200-4. | ||||
| Ref 534022 | Molecular cloning of a mammalian serotonin receptor that activates adenylate cyclase. Mol Pharmacol. 1993 Aug;44(2):229-36. | ||||
| Ref 534025 | Molecular cloning, characterization, and localization of a high-affinity serotonin receptor (5-HT7) activating cAMP formation. Proc Natl Acad Sci U S A. 1993 Sep 15;90(18):8547-51. | ||||
| Ref 534026 | A novel adenylyl cyclase-activating serotonin receptor (5-HT7) implicated in the regulation of mammalian circadian rhythms. Neuron. 1993 Sep;11(3):449-58. | ||||
| Ref 534463 | Cloning, expression and pharmacology of a truncated splice variant of the human 5-HT7 receptor (h5-HT7b). Br J Pharmacol. 1997 Sep;122(1):126-32. | ||||
| Ref 534474 | Human serotonin 5-HT7 receptor: cloning and pharmacological characterisation of two receptor variants. FEBS Lett. 1997 Aug 25;413(3):489-94. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.