Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T97071
|
||||
| Former ID |
TTDS00441
|
||||
| Target Name |
Glutamate carboxypeptidase II
|
||||
| Gene Name |
FOLH1
|
||||
| Synonyms |
FGCP; Folate hydrolase 1; Folylpoly-gamma-glutamate carboxypeptidase; MGCP; Membrane glutamate carboxypeptidase; N-acetylated-alpha-linked acidic dipeptidase I; NAALADase I; PSM; PSMA; Prostate-specific membrane antigen; Pteroylpoly-gamma-glutamate carboxypeptidase; FOLH1
|
||||
| Target Type |
Successful
|
||||
| Disease | Brain injury [ICD10: S09.90] | ||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Influenza virus [ICD10: J11.1] | |||||
| Metastatic prostate cancer; Non-metastatic prostate cancer [ICD9: 140-229, 185; ICD10: C61] | |||||
| Neuropathic pain [ICD9: 356.0, 356.8; ICD10: G64, G90.0] | |||||
| Prostate cancer diagnosis [ICD9: 140-229, 185; ICD10: C61] | |||||
| Prostate cancer [ICD9: 185; ICD10: C61] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
Has both folate hydrolase and n-acetylated-alpha-linked- acidic dipeptidase (naaladase) activity. Has a preference for tri- alpha-glutamate peptides. In the intestine, required for the uptake of folate. In the brain, modulates excitatory neurotransmission.
|
||||
| BioChemical Class |
Peptidase
|
||||
| Target Validation |
T97071
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.4.17.21
|
||||
| Sequence |
MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKA
FLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYP NKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYA RTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVK SYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYY DAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIG TLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFAS WDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKE LKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKN WETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDY AVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIV LRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVD PSKAWGEVKRQIYVAAFTVQAAAETLSEVA |
||||
| Structure |
1Z8L; 2C6C; 2C6G; 2C6P; 2CIJ; 2JBJ; 2JBK; 2OOT; 2OR4; 2PVV; 2PVW; 2XEF; 2XEG; 2XEI; 2XEJ; 3BHX; 3BI0; 3BI1; 3BXM; 3D7D; 3D7F; 3D7G; 3D7H; 3IWW; 3RBU; 3SJE; 3SJF; 3SJG; 3SJX; 4JYW; 4JZ0; 4LQG; 4MCP; 4MCQ; 4MCR; 4MCS; 4NGM; 4NGN; 4NGP; 4NGQ; 4NGR; 4NGS; 4NGT; 4OC0; 4OC1; 4OC2; 4OC3; 4OC4; 4OC5; 1Z8L; 2C6C; 2C6G; 2C6P; 2CIJ; 2JBJ; 2JBK;2OOT; 2OR4; 2PVV; 2PVW; 2XEF; 2XEG; 2XEI; 2XEJ; 3BHX; 3BI0; 3BI1; 3BXM; 3D7D; 3D7F; 3D7G; 3D7H; 3IWW; 3RBU; 3SJE; 3SJF; 3SJG; 3SJX; 4JYW; 4JZ0; 4LQG; 4MCP; 4MCQ; 4MCR; 4MCS; 4NGM; 4NGN; 4NGP; 4NGQ; 4NGR; 4NGS; 4NGT; 4OC0; 4OC1; 4OC2; 4OC3; 4OC4; 4OC5
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Capromab | Drug Info | Approved | Prostate cancer diagnosis | [538379], [541934], [551871] |
| 99mTc-MIP-1404 | Drug Info | Phase 2 | Prostate cancer | [524028] | |
| ATL101 | Drug Info | Phase 2 | Influenza virus | [550302] | |
| G-202 | Drug Info | Phase 2 | Solid tumours | [524201] | |
| J 591 Lu-177 | Drug Info | Phase 2 | Metastatic prostate cancer; Non-metastatic prostate cancer | [532377] | |
| MLN-591RL | Drug Info | Phase 2 | Prostate cancer | [521697] | |
| MLN-2704 | Drug Info | Phase 1/2 | Prostate cancer | [521575] | |
| 99mTc-MIP-1405 | Drug Info | Phase 1 | Prostate cancer | [523296] | |
| Autologous T-cell therapy | Drug Info | Phase 1 | Prostate cancer | [525412] | |
| BAY-1075553 | Drug Info | Phase 1 | Prostate cancer | [551775] | |
| GPI-16072 | Drug Info | Phase 1 | Neuropathic pain | [536447] | |
| Iofolastat I-124 | Drug Info | Phase 1 | Prostate cancer | [548537] | |
| MT-112 | Drug Info | Phase 1 | Solid tumours | [549000] | |
| PSMA subunit vaccine | Drug Info | Phase 1 | Prostate cancer | [550234] | |
| PSMA-targeted tubulysin B conjugates | Drug Info | Phase 1 | Prostate cancer | [549705] | |
| PSMA-VRP | Drug Info | Phase 1 | Prostate cancer | [547026] | |
| IRX-4 | Drug Info | Preclinical | Prostate cancer | [548530] | |
| MDX-070 | Drug Info | Discontinued in Phase 2 | Prostate cancer | [547384] | |
| 2-PMPA | Drug Info | Terminated | Discovery agent | [546702] | |
| Inhibitor | 2-(2-carboxy-5-mercaptopentyl)benzoic acid | Drug Info | [528194] | ||
| 2-(2-carboxy-7-mercaptoheptyl)benzoic acid | Drug Info | [528194] | |||
| 2-(2-Hydroxycarbamoyl-ethyl)-pentanedioic acid | Drug Info | [526637] | |||
| 2-(2-Mercapto-ethyl)-pentanedioic acid | Drug Info | [526615] | |||
| 2-(2-Phosphonooxy-ethyl)-pentanedioic acid | Drug Info | [526615] | |||
| 2-(3-carbamoylbenzyl)-5-mercaptopentanoic acid | Drug Info | [528194] | |||
| 2-(3-carboxybenzyl)succinic acid | Drug Info | [528194] | |||
| 2-(3-cyanobenzyl)-5-mercaptopentanoic acid | Drug Info | [528194] | |||
| 2-(3-Hydroxycarbamoyl-propyl)-pentanedioic acid | Drug Info | [526637] | |||
| 2-(3-Mercapto-propyl)-pentanedioic acid | Drug Info | [526615] | |||
| 2-(3-Methylsulfanyl-propyl)-pentanedioic acid | Drug Info | [526615] | |||
| 2-(4-Mercapto-butyl)-pentanedioic acid | Drug Info | [526615] | |||
| 2-(5-Mercapto-pentyl)-pentanedioic acid | Drug Info | [526615] | |||
| 2-(phosphonomethyl)pentanedioic acid | Drug Info | [529200] | |||
| 2-benzyl-5-mercaptopentanoic acid | Drug Info | [528194] | |||
| 2-Hydroxycarbamoyl-pentanedioic acid | Drug Info | [526637] | |||
| 2-Hydroxycarbamoylmethyl-pentanedioic acid | Drug Info | [526637] | |||
| 2-Mercapto-pentanedioic acid | Drug Info | [526615] | |||
| 2-Mercaptomethyl-pentanedioic acid | Drug Info | [526615] | |||
| 2-Phosphonooxy-pentanedioic acid | Drug Info | [526615] | |||
| 2-PMPA | Drug Info | [534932] | |||
| 3-(1-carboxy-4-mercaptobutoxy)benzoic acid | Drug Info | [528194] | |||
| 3-(2-carbamoyl-5-mercaptopentyl)benzoic acid | Drug Info | [528194] | |||
| 3-(2-carboxy-3-mercaptopropyl)benzoic acid | Drug Info | [528194] | |||
| 3-(2-carboxy-3-phosphonopropyl)benzoic acid | Drug Info | [528194] | |||
| 3-(2-carboxy-4-mercaptobutyl)benzoic acid | Drug Info | [528194] | |||
| 3-(2-carboxy-5-mercaptopentyl)benzoic acid | Drug Info | [528194] | |||
| 3-(2-carboxy-6-mercaptohexyl)benzoic acid | Drug Info | [528194] | |||
| 3-[(1-carboxy-4-mercaptobutyl)thio]benzoic acid | Drug Info | [528194] | |||
| 4-(2-carboxy-5-mercaptopentyl)benzoic acid | Drug Info | [528194] | |||
| 5-Mercapto-pentanoic acid | Drug Info | [526615] | |||
| compound 8d | Drug Info | [527004] | |||
| G-202 | Drug Info | [550453] | |||
| GPI-16072 | Drug Info | [536374] | |||
| Iofolastat I-124 | Drug Info | [531520] | |||
| MIP-1375 | Drug Info | [543445] | |||
| PGI-02749 | Drug Info | [543445] | |||
| QUISQUALATE | Drug Info | [528891] | |||
| Modulator | 99mTc-MIP-1340 | Drug Info | [543445] | ||
| 99mTc-MIP-1404 | Drug Info | [532384] | |||
| 99mTc-MIP-1405 | Drug Info | [532384] | |||
| ATL101 | Drug Info | [550303] | |||
| BAY-1075553 | Drug Info | [532458] | |||
| CTT-54 | Drug Info | [543445] | |||
| J 591 Lu-177 | Drug Info | [532377] | |||
| MDX-1147 | Drug Info | [543445] | |||
| PSMA-targeted tubulysin B conjugates | Drug Info | [530072] | |||
| Immunomodulator (Immunostimulant) | IRX-4 | Drug Info | [532510] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Alanine, aspartate and glutamate metabolism | ||||
| Metabolic pathways | |||||
| Vitamin digestion and absorption | |||||
| NetPath Pathway | TCR Signaling Pathway | ||||
| TNFalpha Signaling Pathway | |||||
| Reactome | Amino acid synthesis and interconversion (transamination) | ||||
| WikiPathways | One Carbon Metabolism | ||||
| References | |||||
| Ref 521575 | ClinicalTrials.gov (NCT00070837) MLN2704 in Subjects With Metastatic Androgen-Independent Prostate Cancer. U.S. National Institutes of Health. | ||||
| Ref 521697 | ClinicalTrials.gov (NCT00195039) Treatment With Radiolabeled Monoclonal Antibody HuJ591-GS (177Lu-J591) in Patients With Metastatic Prostate Cancer. U.S. National Institutes of Health. | ||||
| Ref 523296 | ClinicalTrials.gov (NCT01261754) A Study of 99mTc-MIP-1404 and 99mTc-MIP-1405 in Patients With Metastatic Prostate Adenocarcinoma and Healthy Volunteers. U.S. National Institutes of Health. | ||||
| Ref 524028 | ClinicalTrials.gov (NCT01667536) A Phase 2 Diagnostic Imaging Study With 99mTc-MIP-1404 in Men With High-Risk Prostate Cancer Scheduled for Radical Prostatectomy (RP) and Extended Pelvic Lymph Node Dissection (EPLND) Compared to Histopathology. U.S. National Institutes of Health. | ||||
| Ref 524201 | ClinicalTrials.gov (NCT01777594) Study of G-202 as Second-Line Therapy Following Sorafenib in Hepatocellular Carcinoma. U.S. National Institutes of Health. | ||||
| Ref 525412 | Clinical application of genetically modified T cells in cancer therapy. Clin Transl Immunology. 2014 May 16;3(5):e16. doi: 10.1038/cti.2014.7. eCollection 2014. | ||||
| Ref 532377 | Phase II study of Lutetium-177-labeled anti-prostate-specific membrane antigen monoclonal antibody J591 for metastatic castration-resistant prostate cancer. Clin Cancer Res. 2013 Sep 15;19(18):5182-91. | ||||
| Ref 536447 | Emerging disease-modifying therapies for the treatment of motor neuron disease/amyotropic lateral sclerosis. Expert Opin Emerg Drugs. 2007 May;12(2):229-52. | ||||
| Ref 538379 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (BLA) 103608. | ||||
| Ref 541934 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6878). | ||||
| Ref 546702 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009714) | ||||
| Ref 547026 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012200) | ||||
| Ref 547384 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015769) | ||||
| Ref 548530 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026363) | ||||
| Ref 548537 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026421) | ||||
| Ref 549000 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031326) | ||||
| Ref 526615 | J Med Chem. 2003 May 8;46(10):1989-96.Synthesis and biological evaluation of thiol-based inhibitors of glutamate carboxypeptidase II: discovery of an orally active GCP II inhibitor. | ||||
| Ref 526637 | Bioorg Med Chem Lett. 2003 Jul 7;13(13):2097-100.Synthesis and biological evaluation of hydroxamate-Based inhibitors of glutamate carboxypeptidase II. | ||||
| Ref 527004 | Synthesis of urea-based inhibitors as active site probes of glutamate carboxypeptidase II: efficacy as analgesic agents. J Med Chem. 2004 Mar 25;47(7):1729-38. | ||||
| Ref 528194 | J Med Chem. 2006 May 18;49(10):2876-85.Structural optimization of thiol-based inhibitors of glutamate carboxypeptidase II by modification of the P1' side chain. | ||||
| Ref 528891 | J Med Chem. 2007 Jul 12;50(14):3267-73. Epub 2007 Jun 14.Structural insight into the pharmacophore pocket of human glutamate carboxypeptidase II. | ||||
| Ref 529200 | Bioorg Med Chem. 2008 Feb 15;16(4):1648-57. Epub 2007 Nov 17.Design and synthesis of a siderophore conjugate as a potent PSMA inhibitor and potential diagnostic agent for prostate cancer. | ||||
| Ref 529391 | Phase I trial of the prostate-specific membrane antigen-directed immunoconjugate MLN2704 in patients with progressive metastatic castration-resistant prostate cancer. J Clin Oncol. 2008 May 1;26(13):2147-54. | ||||
| Ref 530072 | Prostate-specific membrane antigen targeted imaging and therapy of prostate cancer using a PSMA inhibitor as a homing ligand. Mol Pharm. 2009 May-Jun;6(3):780-9. | ||||
| Ref 531520 | 123I-MIP-1072, a small-molecule inhibitor of prostate-specific membrane antigen, is effective at monitoring tumor response to taxane therapy. J Nucl Med. 2011 Jul;52(7):1087-93. | ||||
| Ref 532158 | A phase I dose escalation trial of vaccine replicon particles (VRP) expressing prostate-specific membrane antigen (PSMA) in subjects with prostate cancer. Vaccine. 2013 Jan 30;31(6):943-9. | ||||
| Ref 532162 | Antitumor activities of PSMA?CD3 diabodies by redirected T-cell lysis of prostate cancer cells. Immunotherapy. 2013 Jan;5(1):27-38. | ||||
| Ref 532377 | Phase II study of Lutetium-177-labeled anti-prostate-specific membrane antigen monoclonal antibody J591 for metastatic castration-resistant prostate cancer. Clin Cancer Res. 2013 Sep 15;19(18):5182-91. | ||||
| Ref 532384 | 99mTc-labeled small-molecule inhibitors of prostate-specific membrane antigen for molecular imaging of prostate cancer. J Nucl Med. 2013 Aug;54(8):1369-76. | ||||
| Ref 532458 | Preclinical evaluation of BAY 1075553, a novel (18)F-labelled inhibitor of prostate-specific membrane antigen for PET imaging of prostate cancer. Eur J Nucl Med Mol Imaging. 2014 Jan;41(1):89-101. | ||||
| Ref 532510 | Irx4 identifies a chamber-specific cell population that contributes to ventricular myocardium development. Dev Dyn. 2014 Mar;243(3):381-92. | ||||
| Ref 533245 | Indium 111-labeled J591 anti-PSMA antibody for vascular targeted imaging in progressive solid tumors. EJNMMI Res. 2015 Apr 29;5:28. | ||||
| Ref 534932 | Selective inhibition of NAALADase, which converts NAAG to glutamate, reduces ischemic brain injury. Nat Med. 1999 Dec;5(12):1396-402. | ||||
| Ref 536323 | Synergistic value of single-photon emission computed tomography/computed tomography fusion to radioimmunoscintigraphic imaging of prostate cancer. Semin Nucl Med. 2007 Jan;37(1):17-28. | ||||
| Ref 543445 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1606). | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.