Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T42446
|
||||
Former ID |
TTDS00022
|
||||
Target Name |
Gamma-aminobutyric acid B receptor
|
||||
Gene Name |
GABBR2
|
||||
Synonyms |
GABA B receptor; GABA(B) receptor; GABAB receptor; Gamma-aminobutyric acid type b receptor; GABBR2
|
||||
Target Type |
Successful
|
||||
Disease | Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42] | ||||
Absence seizures [ICD10: G40] | |||||
Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
Depression [ICD9: 311; ICD10: F30-F39] | |||||
Drug abuse [ICD9: 303-304; ICD10: F10-F19] | |||||
Fragile X syndrome [ICD9: 332, 759.83; ICD10: F02.3, G20, Q99.2] | |||||
Nicotine dependence [ICD9: 305.1; ICD10: F17] | |||||
Partial seizures [ICD9: 345.4, 345.5; ICD10: G40.0, G40.2] | |||||
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
Schizophrenia [ICD9: 295; ICD10: F20] | |||||
Function |
Component of a heterodimeric G-protein coupledreceptor for GABA, formed by GABBR1 and GABBR2. Within the heterodimeric GABA receptor, only GABBR1 seems to bind agonists, while GABBR2 mediates coupling to G proteins. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylatecyclase, stimulates phospholipase A2, activates potassium channels, inactivates voltage-dependent calcium-channels and modulates inositol phospholipid hydrolysis. Plays a critical role in the fine-tuning of inhibitory synaptic transmission. Pre-synaptic GABA receptor inhibits neurotransmitter release by down-regulating high-voltage activated calcium channels, whereas postsynaptic GABA receptor decreases neuronal excitability by activating a prominent inwardly rectifying potassium (Kir) conductance that underlies the late inhibitory postsynaptic potentials. Not only implicated in synaptic inhibition but also in hippocampal long-term potentiation, slow wave sleep, muscle relaxation and antinociception.
|
||||
BioChemical Class |
GPCR glutamate
|
||||
Target Validation |
T42446
|
||||
UniProt ID | |||||
Sequence |
MASPRSSGQPGPPPPPPPPPARLLLLLLLPLLLPLAPGAWGWARGAPRPPPSSPPLSIMG
LMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDA IKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDN AVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSV KKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSS RCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYD GIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNG ERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLP LYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLD GSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVI VGGMLLIDLCILICWQAVDPLRRTVEKYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIV YAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQ FCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSV NQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNL GNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILH HAYLPSIGGVDASCVSPCVSPTASPRHRHVPPSFRVMVSGL |
||||
Structure |
4F11; 4F12; 4MQE; 4MQF; 4MR7; 4MR8; 4MR9; 4MRM; 4MS1; 4MS3; 4MS4; 4PAS; 4MQE; 4MQF; 4MR7; 4MR8; 4MR9; 4MRM; 4MS1; 4MS3; 4MS4; 4PAS
|
||||
Drugs and Mode of Action | |||||
Drug(s) | Gabapentin | Drug Info | Approved | Partial seizures | [536756], [540883] |
Progabide | Drug Info | Approved | Depression | [536361] | |
Gabapentin | Drug Info | Phase 3 | Cancer | [540883], [551871] | |
STX209 | Drug Info | Phase 3 | Fragile X syndrome | [524095] | |
SGS742 | Drug Info | Phase 2 | Schizophrenia | [527226] | |
SCH 50911 | Drug Info | Terminated | Absence seizures | [538658], [545982] | |
Inhibitor | ((E)-3-Amino-propenyl)-methyl-phosphinic acid | Drug Info | [533678] | ||
((Z)-3-Amino-propenyl)-methyl-phosphinic acid | Drug Info | [533678] | |||
(3-Amino-1-ethyl-propyl)-methyl-phosphinic acid | Drug Info | [533678] | |||
(3-Amino-1-hydroxy-propyl)-methyl-phosphinic acid | Drug Info | [533678] | |||
(3-Amino-phenyl)-phosphonic acid diphenyl ester | Drug Info | [533549] | |||
(3-Amino-propyl)-difluoromethyl-phosphinic acid | Drug Info | [533678] | |||
(3-Amino-propyl)-hexyl-phosphinic acid | Drug Info | [551250] | |||
(3-Amino-propyl)-hydroxymethyl-phosphinic acid | Drug Info | [533678] | |||
(3-Amino-propyl)-phosphonic acid | Drug Info | [533549] | |||
(R)-4-Amino-3-(4-chloro-phenyl)-butyric acid | Drug Info | [525508] | |||
(R)-5-Amino-3-(4-chloro-phenyl)-pentanoic acid | Drug Info | [525508] | |||
3-Amino-propane-1-sulfonic acid | Drug Info | [551250] | |||
3-ammoniopropane-1-sulfinate | Drug Info | [551302] | |||
4-Amino-3-(2-chloro-phenyl)-butyric acid | Drug Info | [528071] | |||
4-Amino-3-(4-fluoro-phenyl)-butyric acid | Drug Info | [528071] | |||
4-Amino-3-(5-bromo-thiophen-2-yl)-butyric acid | Drug Info | [528071] | |||
4-Amino-3-(5-chloro-thiophen-2-yl)-butyric acid | Drug Info | [528071] | |||
4-Amino-3-(5-methyl-thiophen-2-yl)-butyric acid | Drug Info | [528071] | |||
4-Amino-3-benzofuran-2-yl-butyric acid | Drug Info | [533413] | |||
4-Amino-3-thiophen-2-yl-butyric acid | Drug Info | [528071] | |||
CGP-27492 | Drug Info | [551250] | |||
CGP-34938 | Drug Info | [533678] | |||
CGP-35024 | Drug Info | [551250] | |||
CGP-35582 | Drug Info | [533678] | |||
CGP-36216 | Drug Info | [551250] | |||
GAMMA-AMINO-BUTANOIC ACID | Drug Info | [528071] | |||
Antagonist | 2-hydroxy-saclofen | Drug Info | [534343] | ||
CGP 54626A | Drug Info | [534343] | |||
CGP 56999A | Drug Info | [534343] | |||
CGP 62349 | Drug Info | [534343] | |||
CGP 64213 | Drug Info | [534343] | |||
CGP 71872 | Drug Info | [534343] | |||
Gabapentin | Drug Info | [536257] | |||
Phaclofen | Drug Info | [536904], [537283] | |||
saclofen | Drug Info | [534343] | |||
SCH 50911 | Drug Info | [534893] | |||
[125I]CGP 64213 | Drug Info | [534343] | |||
[125I]CGP 71872 | Drug Info | [534343] | |||
Agonist | amino-propylphosphinic acid | Drug Info | [534343] | ||
CGP 47656 | Drug Info | [534343] | |||
CGP-44532 | Drug Info | [534908], [536166] | |||
Progabide | Drug Info | [537721], [537874], [538077] | |||
SKF-97541 | Drug Info | [534908] | |||
TG-3030 | Drug Info | [543621] | |||
Modulator | BHF-177 | Drug Info | [543621] | ||
CGP-29030A | Drug Info | [526723], [551871] | |||
GABA-B receptor PAM | Drug Info | [543621] | |||
SGS742 | Drug Info | [527226] | |||
STX209 | Drug Info | [543621] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | cAMP signaling pathway | ||||
Neuroactive ligand-receptor interaction | |||||
GABAergic synapse | |||||
Estrogen signaling pathway | |||||
Morphine addiction | |||||
Reactome | Activation of G protein gated Potassium channels | ||||
G alpha (i) signalling events | |||||
Class C/3 (Metabotropic glutamate/pheromone receptors) | |||||
Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits | |||||
WikiPathways | GPCRs, Class C Metabotropic glutamate, pheromone | ||||
Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell | |||||
Potassium Channels | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
References | |||||
Ref 524095 | ClinicalTrials.gov (NCT01706523) Open Label Extension Study of STX209 (Arbaclofen) in Autism Spectrum Disorders. U.S. National Institutes of Health. | ||||
Ref 527226 | SGS742: the first GABA(B) receptor antagonist in clinical trials. Biochem Pharmacol. 2004 Oct 15;68(8):1479-87. | ||||
Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
Ref 536756 | Use of second-generation antiepileptic drugs in the pediatric population. Paediatr Drugs. 2008;10(4):217-54. | ||||
Ref 538658 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1075). | ||||
Ref 540883 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5483). | ||||
Ref 525508 | J Med Chem. 1999 Jun 3;42(11):2053-9.Synthesis and pharmacology of the baclofen homologues 5-amino-4-(4-chlorophenyl)pentanoic acid and the R- and S-enantiomers of 5-amino-3-(4-chlorophenyl)pentanoicacid. | ||||
Ref 526723 | Effects of a novel piperazine derivative (CGP 29030A) on nociceptive dorsal horn neurons in the rat. Drugs Exp Clin Res. 1992;18(11-12):447-59. | ||||
Ref 527226 | SGS742: the first GABA(B) receptor antagonist in clinical trials. Biochem Pharmacol. 2004 Oct 15;68(8):1479-87. | ||||
Ref 528071 | J Med Chem. 1991 Aug;34(8):2557-60.3-Thienyl- and 3-furylaminobutyric acids. Synthesis and binding GABAB receptor studies. | ||||
Ref 533413 | J Med Chem. 1987 Apr;30(4):743-6.Synthesis and pharmacological evaluation of gamma-aminobutyric acid analogues. New ligand for GABAB sites. | ||||
Ref 533549 | J Med Chem. 1984 May;27(5):654-9.Phosphorus analogues of gamma-aminobutyric acid, a new class of anticonvulsants. | ||||
Ref 533678 | J Med Chem. 1995 Aug 18;38(17):3297-312.Phosphinic acid analogues of GABA. 1. New potent and selective GABAB agonists. | ||||
Ref 534343 | Expression cloning of GABA(B) receptors uncovers similarity to metabotropic glutamate receptors. Nature. 1997 Mar 20;386(6622):239-46. | ||||
Ref 534893 | Activation of nigral dopamine neurons by the selective GABA(B)-receptor antagonist SCH 50911. J Neural Transm. 1999;106(5-6):383-94. | ||||
Ref 534908 | Inhibition of transient LES relaxations and reflux in ferrets by GABA receptor agonists. Am J Physiol. 1999 Oct;277(4 Pt 1):G867-74. | ||||
Ref 536257 | Gabapentin increases a tonic inhibitory conductance in hippocampal pyramidal neurons. Anesthesiology. 2006 Aug;105(2):325-33. | ||||
Ref 536904 | The role of group II and III metabotropic glutamate receptors in modulation of miniature synaptic activity in frog spinal cord motoneurons. Tsitologiia. 2008;50(9):747-56. | ||||
Ref 537283 | Astrocytes and Interneurons in Memory Processing in the Chick Hippocampus: Roles for G-Coupled Protein Receptors, GABA(B) and mGluR1. Neurochem Res. 2009 May 5. | ||||
Ref 537721 | Suppression by progabide of ethanol withdrawal syndrome in rats. Eur J Pharmacol. 1985 Mar 12;109(3):321-5. | ||||
Ref 537874 | Pentobarbital-like discriminative stimulus effects of direct GABA agonists in rats. Psychopharmacology (Berl). 1993;110(3):295-301. | ||||
Ref 538077 | Interactions between dopamine and GABA in the control of ambulatory activity and neophobia in the mouse. Pharmacol Biochem Behav. 1998 Jan;59(1):239-47. | ||||
Ref 543621 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 241). | ||||
Ref 551250 | Biological activity of 3-aminopropyl (methyl) phosphinic acid, a potent and selective GABAB agonist with CNS activity, Bioorg. Med. Chem. Lett. 3(4):515-518 (1993). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.