Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T11072
|
||||
Former ID |
TTDS00100
|
||||
Target Name |
5-hydroxytryptamine 1D receptor
|
||||
Gene Name |
HTR1D
|
||||
Synonyms |
5-HT-1D; 5-HT-1D-alpha; 5-HT1D receptor; 5-hydroxytryptamine receptor 1D; 5HT1D; Serotonin receptor; Serotonin receptor 1D; HTR1D
|
||||
Target Type |
Successful
|
||||
Disease | Acute migraine [ICD9: 346; ICD10: G43] | ||||
Epilepsy [ICD10: G40] | |||||
Insomnia [ICD9: 307.41, 307.42, 327.0, 780.51, 780.52; ICD10: F51.0, G47.0] | |||||
Mood disorder [ICD10: F30-F39] | |||||
Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32] | |||||
Migraine headaches [ICD9: 346; ICD10: G43] | |||||
Migraine [ICD9: 346; ICD10: G43] | |||||
Severe mood disorders [ICD9: 296; ICD10: F30-F39] | |||||
Function |
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Regulates the release of 5-hydroxytryptamine in the brain, and thereby affects neural activity. May also play a role in regulating the release of other neurotransmitters. May play a role in vasoconstriction.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
Target Validation |
T11072
|
||||
UniProt ID | |||||
Sequence |
MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN EEFRQAFQKIVPFRKAS |
||||
Drugs and Mode of Action | |||||
Drug(s) | Almogran | Drug Info | Approved | Migraine | [550661] |
Dihydroergotamine nasal | Drug Info | Approved | Migraine | [551730] | |
Eletriptan | Drug Info | Approved | Migraine | [536361], [540615] | |
Frovatriptan | Drug Info | Approved | Migraine headaches | [536361], [542203] | |
Rizatriptan | Drug Info | Approved | Acute migraine | [468161], [538326] | |
Sumatriptan | Drug Info | Approved | Migraine headaches | [536361], [540805] | |
Zolmitriptan | Drug Info | Approved | Migraine | [538555], [541265] | |
Neu-P11 | Drug Info | Phase 2 | Insomnia | [523722] | |
NXN-188 | Drug Info | Phase 2 | Migraine | [522692] | |
TGBA01AD | Drug Info | Phase 2 | Severe mood disorders | [536580] | |
Tonabersat | Drug Info | Phase 2 | Epilepsy | [522123] | |
Donitriptan | Drug Info | Preclinical | Migraine | [540538], [547009] | |
Alniditan | Drug Info | Discontinued in Phase 3 | Migraine | [538712], [546088] | |
Avitriptan | Drug Info | Discontinued in Phase 3 | Migraine | [545344] | |
BMS-181101 | Drug Info | Discontinued in Phase 2 | Mood disorder | [538662], [545877] | |
CP-122288 | Drug Info | Discontinued in Phase 2 | Migraine | [538675], [545996] | |
Elzasonan hydrochloride | Drug Info | Discontinued in Phase 2 | Severe mood disorders | [536580] | |
IS-159 | Drug Info | Discontinued in Phase 2 | Migraine | [545995] | |
PNU-142633 | Drug Info | Discontinued in Phase 2 | Migraine | [547202] | |
ALX-0646 | Drug Info | Discontinued in Phase 1 | Migraine | [546474] | |
Tidembersat | Drug Info | Discontinued in Phase 1 | Migraine | [546798] | |
BMS-181885 | Drug Info | Terminated | Migraine | [546243] | |
GR-127935 | Drug Info | Terminated | Major depressive disorder | [538876], [545301] | |
L-694247 | Drug Info | Terminated | Migraine | [538938], [545490] | |
L-741604 | Drug Info | Terminated | Discovery agent | [546098] | |
L-775606 | Drug Info | Terminated | Discovery agent | [538680], [546600] | |
PNU-109291 | Drug Info | Terminated | Migraine | [540203], [546823] | |
VR-147 | Drug Info | Terminated | Migraine | [548264] | |
Inhibitor | (+/-)-nantenine | Drug Info | [530558] | ||
(3-Chloro-phenyl)-piperazin-1-yl-methanone | Drug Info | [533476] | |||
1,2,3,4-Tetrahydro-naphthalen-2-ylamine | Drug Info | [533482] | |||
1-((S)-2-aminopropyl)-1H-indazol-6-ol | Drug Info | [527952] | |||
1-(2,5-Dimethoxy-4-methyl-phenyl)-piperazine | Drug Info | [533476] | |||
1-(2,5-Dimethoxy-phenyl)-piperazine | Drug Info | [533476] | |||
1-(2,5-dimethoxyphenyl)propan-2-amine | Drug Info | [533498] | |||
1-(2-Butoxy-phenyl)-piperazine | Drug Info | [533134] | |||
1-(2-Ethoxy-phenyl)-piperazine | Drug Info | [533134] | |||
1-(2-Fluoro-phenyl)-piperazine | Drug Info | [533134] | |||
1-(2-Isopropoxy-phenyl)-piperazine | Drug Info | [533134] | |||
1-(2-Methoxy-phenyl)-piperazine | Drug Info | [533134] | |||
1-(3-(pentafluorosulfanyl)phenyl)propan-2-amine | Drug Info | [529013] | |||
1-(3-Fluoro-phenyl)-piperazine | Drug Info | [533134] | |||
1-(3-Nitro-phenyl)-piperazine | Drug Info | [533134] | |||
1-(3-Trifluoromethyl-phenyl)-piperazine | Drug Info | [533476] | |||
1-(4-Bromo-2,5-dimethoxy-phenyl)-piperazine | Drug Info | [533476] | |||
1-(7-Methoxy-naphthalen-2-yl)-piperazine | Drug Info | [534528] | |||
1-Naphthalen-1-yl-piperazine | Drug Info | [533482] | |||
1-Naphthalen-2-yl-piperazine | Drug Info | [533482] | |||
2-(2,6-Dimethyl-benzyl)-4,5-dihydro-1H-imidazole | Drug Info | [527180] | |||
2-(2-Amino-propyl)-5-bromo-4-methoxy-phenol | Drug Info | [533498] | |||
2-(2-Methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [533498] | |||
2-(3-Methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [533498] | |||
2-(4-Bromo-2-methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [533498] | |||
2-(4-Bromo-phenyl)-1-methyl-ethylamine | Drug Info | [533498] | |||
2-(4-tert-Butyl-phenyl)-4,5-dihydro-1H-imidazole | Drug Info | [527180] | |||
2-(5-Nonyloxy-1H-indol-3-yl)-ethylamine | Drug Info | [533876] | |||
2-(5-Thiophen-2-yl-1H-indol-3-yl)-ethylamine | Drug Info | [525792] | |||
2-Piperazin-1-yl-benzonitrile | Drug Info | [533134] | |||
2-Piperazin-1-yl-phenol | Drug Info | [533476] | |||
3-Amino-1-(2-amino-5-methoxy-phenyl)-propan-1-one | Drug Info | [533476] | |||
5,6-dichloro-3,4-dihydroquinazolin-2-amine | Drug Info | [529148] | |||
5-amino-3-(N-methylpiperidin-4-yl)-1H-indole | Drug Info | [529496] | |||
5-chloro-3,4-dihydroquinazolin-2-amine | Drug Info | [529148] | |||
5-chloro-4-methyl-3,4-dihydroquinazolin-2-amine | Drug Info | [529148] | |||
5-Ethyl-3-(2-pyrrolidin-1-yl-ethyl)-1H-indole | Drug Info | [525845] | |||
5-Isopropyl-3-(2-pyrrolidin-1-yl-ethyl)-1H-indole | Drug Info | [525845] | |||
8-Methoxy-2-(4-methyl-piperazin-1-yl)-quinoline | Drug Info | [533482] | |||
8-Methoxy-2-piperazin-1-yl-quinoline | Drug Info | [533482] | |||
8-methoxy-4-methyl-3,4-dihydroquinazolin-2-amine | Drug Info | [529148] | |||
8-Methoxy-quinolin-2-ylamine | Drug Info | [533482] | |||
AGROCLAVINE | Drug Info | [532683] | |||
Brolamfetamine | Drug Info | [533498] | |||
CHLOROPHENYLPIPERAZINE | Drug Info | [533134] | |||
Etisulergine | Drug Info | [533501] | |||
L-741604 | Drug Info | [525431] | |||
L-747201 | Drug Info | [534500] | |||
L-760790 | Drug Info | [525431] | |||
L-775606 | Drug Info | [529496] | |||
PHENYLPIPERAZINE | Drug Info | [533482] | |||
QUIPAZINE | Drug Info | [533482] | |||
SEROTONIN | Drug Info | [529496] | |||
WAY-466 | Drug Info | [527381] | |||
[2-(5-Ethyl-1H-indol-3-yl)-ethyl]-dimethyl-amine | Drug Info | [525845] | |||
Agonist | 1-naphthylpiperazine | Drug Info | [527380] | ||
2-methyl-5-HT | Drug Info | [534292] | |||
5-CT | Drug Info | [528072] | |||
7-methoxy-1-naphthylpiperazine | Drug Info | [534528] | |||
Almogran | Drug Info | [535330] | |||
Alniditan | Drug Info | [534635], [551730] | |||
alpha-methyl-5-HT | Drug Info | [534292] | |||
ALX-0646 | Drug Info | [551730] | |||
Avitriptan | Drug Info | [534756], [551730] | |||
BMS-181885 | Drug Info | [525577], [551730] | |||
BRL-15572 | Drug Info | [534475] | |||
CP-122288 | Drug Info | [534381], [551730] | |||
dipropyl-5-CT | Drug Info | [527380] | |||
EMDT | Drug Info | [525722] | |||
L-694247 | Drug Info | [533978], [551730] | |||
lysergic acid | Drug Info | [534292] | |||
lysergol | Drug Info | [527380] | |||
Neu-P11 | Drug Info | [551415] | |||
PNU-109291 | Drug Info | [531636], [551730] | |||
PNU-142633 | Drug Info | [526906], [551730] | |||
Rizatriptan | Drug Info | [535607] | |||
SB 216641 | Drug Info | [534475] | |||
Sumatriptan | Drug Info | [534894], [534966], [535146], [535803], [538154] | |||
TFMPP | Drug Info | [528072] | |||
Tonabersat | Drug Info | [525903], [551730] | |||
[125I]GTI | Drug Info | [533994] | |||
[3H]5-CT | Drug Info | [525563] | |||
[3H]5-HT | Drug Info | [534635] | |||
[3H]8-OH-DPAT | Drug Info | [525553] | |||
[3H]alniditan | Drug Info | [534635] | |||
[3H]eletriptan | Drug Info | [525461] | |||
[3H]sumatriptan | Drug Info | [525461] | |||
Antagonist | 9-OH-risperidone | Drug Info | [534281] | ||
BMS-181101 | Drug Info | [525577], [551730] | |||
bufotenine | Drug Info | [534292] | |||
L-772,405 | Drug Info | [525646] | |||
m-chlorophenylpiperazine | Drug Info | [528072] | |||
metergoline | Drug Info | [528072] | |||
MPDT | Drug Info | [525722] | |||
SB 272183 | Drug Info | [526100] | |||
SB 649915 | Drug Info | [527551] | |||
SB 714786 | Drug Info | [527551] | |||
Tidembersat | Drug Info | [551730] | |||
[3H]GR 125,743 | Drug Info | [525563] | |||
Modulator | Dihydroergotamine nasal | Drug Info | [534635] | ||
Donitriptan | Drug Info | ||||
Eletriptan | Drug Info | [556264] | |||
Elzasonan hydrochloride | Drug Info | ||||
Frovatriptan | Drug Info | [556264] | |||
GR-127935 | Drug Info | ||||
IS-159 | Drug Info | ||||
NXN-188 | Drug Info | ||||
TGBA01AD | Drug Info | ||||
VR-147 | Drug Info | [550903], [551730] | |||
Zolmitriptan | Drug Info | [556264] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | cAMP signaling pathway | ||||
Neuroactive ligand-receptor interaction | |||||
Serotonergic synapse | |||||
PANTHER Pathway | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | ||||
5HT1 type receptor mediated signaling pathway | |||||
Reactome | Serotonin receptors | ||||
G alpha (i) signalling events | |||||
WikiPathways | Serotonin HTR1 Group and FOS Pathway | ||||
Monoamine GPCRs | |||||
GPCRs, Class A Rhodopsin-like | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
References | |||||
Ref 468161 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 51). | ||||
Ref 522123 | ClinicalTrials.gov (NCT00534560) Dose Ranging Study of the Efficacy and Tolerability of Tonabersat in the Prophylaxis of Migraine Headache. U.S. National Institutes of Health. | ||||
Ref 522692 | ClinicalTrials.gov (NCT00920686) Study of NXN 188 for the Treatment of Migraine With Aura. U.S. National Institutes of Health. | ||||
Ref 523722 | ClinicalTrials.gov (NCT01489969) Sleep Laboratory Study to Investigate the Safety and Efficacy of Neu-P11 in Primary Insomnia Patients. U.S. National Institutes of Health. | ||||
Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
Ref 536580 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. Epub 2008 Jan 2. | ||||
Ref 538326 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 077263. | ||||
Ref 538555 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 020768. | ||||
Ref 538662 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 108). | ||||
Ref 538675 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 110). | ||||
Ref 538680 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 114). | ||||
Ref 538712 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 120). | ||||
Ref 538876 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 14). | ||||
Ref 538938 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 15). | ||||
Ref 540203 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3228). | ||||
Ref 540538 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 39). | ||||
Ref 540615 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 40). | ||||
Ref 540805 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 54). | ||||
Ref 541265 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 60). | ||||
Ref 542203 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7191). | ||||
Ref 545301 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002743) | ||||
Ref 545344 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002927) | ||||
Ref 545490 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003457) | ||||
Ref 545877 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005177) | ||||
Ref 545995 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005786) | ||||
Ref 545996 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005787) | ||||
Ref 546088 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006286) | ||||
Ref 546098 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006344) | ||||
Ref 546243 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007062) | ||||
Ref 546474 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008400) | ||||
Ref 546600 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009132) | ||||
Ref 546798 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010348) | ||||
Ref 546823 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010481) | ||||
Ref 547009 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012002) | ||||
Ref 547202 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013927) | ||||
Ref 525431 | J Med Chem. 1999 Feb 25;42(4):691-705.3-(Piperazinylpropyl)indoles: selective, orally bioavailable h5-HT1D receptor agonists as potential antimigraine agents. | ||||
Ref 525461 | Characterisation of the 5-HT receptor binding profile of eletriptan and kinetics of [3H]eletriptan binding at human 5-HT1B and 5-HT1D receptors. Eur J Pharmacol. 1999 Mar 5;368(2-3):259-68. | ||||
Ref 525553 | Actions of roxindole at recombinant human dopamine D2, D3 and D4 and serotonin 5-HT1A, 5-HT1B and 5-HT1D receptors. Naunyn Schmiedebergs Arch Pharmacol. 1999 Jun;359(6):447-53. | ||||
Ref 525563 | Serotonin 5-HT1B and 5-HT1D receptors form homodimers when expressed alone and heterodimers when co-expressed. FEBS Lett. 1999 Jul 30;456(1):63-7. | ||||
Ref 525577 | Sensitive triple-quadrupole mass spectrometric assay for the determination of BMS-181885, a 5-HT1 agonist, in human plasma following solid phase extraction. Biomed Chromatogr. 1999 Oct;13(6):425-30. | ||||
Ref 525646 | 3-[3-(Piperidin-1-yl)propyl]indoles as highly selective h5-HT(1D) receptor agonists. J Med Chem. 1999 Dec 2;42(24):4981-5001. | ||||
Ref 525722 | 2-Substituted tryptamines: agents with selectivity for 5-HT(6) serotonin receptors. J Med Chem. 2000 Mar 9;43(5):1011-8. | ||||
Ref 525792 | Bioorg Med Chem Lett. 2000 May 1;10(9):903-5.5-Thienyltryptamine derivatives as serotonin 5-HT1B/1D receptor agonists: potential treatments for migraine. | ||||
Ref 525845 | Bioorg Med Chem Lett. 2000 Aug 7;10(15):1707-9.5-Alkyltryptamine derivatives as highly selective and potent 5-HT1D receptor agonists. | ||||
Ref 525903 | The potential anti-migraine compound SB-220453 does not contract human isolated blood vessels or myocardium; a comparison with sumatriptan. Cephalalgia. 2000 Jul;20(6):538-45. | ||||
Ref 526100 | SB-272183, a selective 5-HT(1A), 5-HT(1B) and 5-HT(1D) receptor antagonist in native tissue. Br J Pharmacol. 2001 Jul;133(6):797-806. | ||||
Ref 526906 | Further characterization of the 5-HT1 receptors mediating cardiac sympatho-inhibition in pithed rats: pharmacological correlation with the 5-HT1B and 5-HT1D subtypes. Naunyn Schmiedebergs Arch Pharmacol. 2004 Feb;369(2):220-7. Epub 2003 Dec 12. | ||||
Ref 527180 | Bioorg Med Chem Lett. 2004 Sep 20;14(18):4697-9.2-(Anilino)imidazolines and 2-(benzyl)imidazoline derivatives as h5-HT1D serotonin receptor ligands. | ||||
Ref 527380 | Human serotonin 1D receptor is encoded by a subfamily of two distinct genes: 5-HT1D alpha and 5-HT1D beta. Proc Natl Acad Sci U S A. 1992 Apr 15;89(8):3630-4. | ||||
Ref 527381 | J Med Chem. 2005 Jan 27;48(2):353-6.Discovery of 5-arylsulfonamido-3-(pyrrolidin-2-ylmethyl)-1H-indole derivatives as potent, selective 5-HT6 receptor agonists and antagonists. | ||||
Ref 527551 | Discovery of the first potent, selective 5-hydroxytryptamine1D receptor antagonist. J Med Chem. 2005 May 19;48(10):3478-80. | ||||
Ref 527952 | J Med Chem. 2006 Jan 12;49(1):318-28.1-((S)-2-aminopropyl)-1H-indazol-6-ol: a potent peripherally acting 5-HT2 receptor agonist with ocular hypotensive activity. | ||||
Ref 528072 | Primary structure and functional characterization of a human 5-HT1D-type serotonin receptor. Mol Pharmacol. 1991 Aug;40(2):143-8. | ||||
Ref 529013 | Bioorg Med Chem. 2007 Nov 1;15(21):6659-66. Epub 2007 Aug 15.The synthesis and biological activity of pentafluorosulfanyl analogs of fluoxetine, fenfluramine, and norfenfluramine. | ||||
Ref 529148 | Bioorg Med Chem Lett. 2008 Jan 1;18(1):256-61. Epub 2007 Oct 30.Cyclic guanidines as dual 5-HT5A/5-HT7 receptor ligands: structure-activity relationship elucidation. | ||||
Ref 529496 | J Med Chem. 2008 Jun 26;51(12):3609-16. Epub 2008 May 29.Designing selective, high affinity ligands of 5-HT1D receptor by covalent dimerization of 5-HT1F ligands derived from 4-fluoro-N-[3-(1-methyl-4-piperidinyl)-1H-indol-5-yl]benzamide. | ||||
Ref 530558 | Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. | ||||
Ref 531636 | Role of 5-HT(1) receptor subtypes in the modulation of pain and synaptic transmission in rat spinal superficial dorsal horn. Br J Pharmacol. 2012 Mar;165(6):1956-65. | ||||
Ref 533134 | J Med Chem. 1989 May;32(5):1052-6.Activity of aromatic substituted phenylpiperazines lacking affinity for dopamine binding sites in a preclinical test of antipsychotic efficacy. | ||||
Ref 533476 | J Med Chem. 1986 May;29(5):630-4.Synthesis and evaluation of phenyl- and benzoylpiperazines as potential serotonergic agents. | ||||
Ref 533482 | J Med Chem. 1986 Nov;29(11):2375-80.5-HT1 and 5-HT2 binding characteristics of some quipazine analogues. | ||||
Ref 533498 | J Med Chem. 1986 Feb;29(2):194-9.5-HT1 and 5-HT2 binding characteristics of 1-(2,5-dimethoxy-4-bromophenyl)-2-aminopropane analogues. | ||||
Ref 533501 | J Med Chem. 1985 Oct;28(10):1540-2.Resolution and absolute configuration of the potent dopamine agonist N,N-diethyl-N'-[(3 alpha, 4a alpha, 10a beta)-1,2,3,4,4a,5,10,10a- -octahydro-6-hydroxy-1-propyl-3-benzo[g]quinolinyl]sulfamide. | ||||
Ref 533876 | J Med Chem. 1994 Sep 2;37(18):2828-30.5-(Nonyloxy)tryptamine: a novel high-affinity 5-HT1D beta serotonin receptor agonist. | ||||
Ref 533994 | Autoradiographic characterisation and localisation of 5-HT1D compared to 5-HT1B binding sites in rat brain. Naunyn Schmiedebergs Arch Pharmacol. 1993 Jun;347(6):569-82. | ||||
Ref 534281 | Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl). 1996 Mar;124(1-2):57-73. | ||||
Ref 534292 | Alniditan, a new 5-hydroxytryptamine1D agonist and migraine-abortive agent: ligand-binding properties of human 5-hydroxytryptamine1D alpha, human 5-hydroxytryptamine1D beta, and calf 5-hydroxytryptamine1D receptors investigated with [3H]5-hydroxytryptamine and [3H]alniditan. Mol Pharmacol. 1996 Dec;50(6):1567-80. | ||||
Ref 534381 | The 5-HT1D receptor antagonist GR-127,935 prevents inhibitory effects of sumatriptan but not CP-122,288 and 5-CT on neurogenic plasma extravasation within guinea pig dura mater. Neuropharmacology. 1997 Jan;36(1):83-91. | ||||
Ref 534475 | SB-216641 and BRL-15572--compounds to pharmacologically discriminate h5-HT1B and h5-HT1D receptors. Naunyn Schmiedebergs Arch Pharmacol. 1997 Sep;356(3):312-20. | ||||
Ref 534500 | J Med Chem. 1997 Oct 24;40(22):3501-3.Selective, orally active 5-HT1D receptor agonists as potential antimigraine agents. | ||||
Ref 534528 | J Med Chem. 1997 Nov 21;40(24):3974-8.5-HT1B receptor antagonist properties of novel arylpiperazide derivatives of 1-naphthylpiperazine. | ||||
Ref 534635 | Br J Pharmacol. 1998 Apr;123(8):1655-65.Agonistic properties of alniditan, sumatriptan and dihydroergotamine on human 5-HT1B and 5-HT1D receptors expressed in various mammalian cell lines. | ||||
Ref 534756 | Safety trial with the 5HT1B/1D agonist avitriptan (BMS-180048) in patients with migraine who have experienced pressure, tightness, and/or pain in the chest, neck, and/or throat following sumatriptan.Cephalalgia. 1998 Oct;18(8):546-51. | ||||
Ref 534894 | 5-Hydroxytryptamine(1F) receptors do not participate in vasoconstriction: lack of vasoconstriction to LY344864, a selective serotonin(1F) receptor agonist in rabbit saphenous vein. J Pharmacol Exp Ther. 1999 Sep;290(3):935-9. | ||||
Ref 535146 | Irritable bowel syndrome: new agents targeting serotonin receptor subtypes. Drugs. 2001;61(3):317-32. | ||||
Ref 535330 | Efficacy and tolerability of subcutaneous almotriptan for the treatment of acute migraine: a randomized, double-blind, parallel-group, dose-finding study. Clin Ther. 2001 Nov;23(11):1867-75. | ||||
Ref 535607 | An introduction to migraine: from ancient treatment to functional pharmacology and antimigraine therapy. Proc West Pharmacol Soc. 2002;45:199-210. | ||||
Ref 535803 | 5-Hydroxytryptamine receptor agonists for the abortive treatment of vascular headaches block mast cell, endothelial and platelet activation within the rat dura mater after trigeminal stimulation. Brain Res. 1992 Jun 26;583(1-2):137-49. | ||||
Ref 538154 | Serotonin in migraine: theories, animal models and emerging therapies. Prog Drug Res. 1998;51:219-44. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.