Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T83813
|
||||
| Former ID |
TTDS00105
|
||||
| Target Name |
5-hydroxytryptamine 2C receptor
|
||||
| Gene Name |
HTR2C
|
||||
| Synonyms |
5-HT-2C; 5-HT2C receptor; 5HT-1C; Serotonin receptor; Serotonin receptor 2C; HTR2C
|
||||
| Target Type |
Successful
|
||||
| Disease | Alcohol use disorders [ICD9: 303; ICD10: F10.2] | ||||
| Aggressive non-hodgkin's lymphoma [ICD9: 200, 201, 202, 202.8, 208.9; ICD10: C81, C81-C86, C82-C85, C91-C95] | |||||
| Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42] | |||||
| Depression [ICD9: 311; ICD10: F30-F39] | |||||
| Drug abuse [ICD9: 303-304; ICD10: F10-F19] | |||||
| Generalized anxiety disorder; Major depressive disorder [ICD9:300, 300.02, 311, 296.2, 296.3, 710.0; ICD10: F32, F40-F42, F41.1, F33, M32] | |||||
| Migraine headaches [ICD9: 346; ICD10: G43] | |||||
| Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32] | |||||
| Mood disorder [ICD10: F30-F39] | |||||
| Metabolic disorders [ICD9: 270-279; ICD10: E70-E89] | |||||
| Neurological disease [ICD9: 338, 338.2, 410, 782.3,780; ICD10: I21, I22, R52, R52.1-R52.2, R60.9, G89] | |||||
| Obesity [ICD9: 278; ICD10: E66] | |||||
| Obesity; Diabetes [ICD9: 250, 278; ICD10: E08-E13, E66] | |||||
| Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
| Psychotic disorders [ICD9: 290-299; ICD10: F20-F29] | |||||
| Sleep initiation and maintenance disorders; Primary insomnia; Schizophrenia [ICD9: 295, 307.41, 307.42, 327.0, 780.51, 780.52; ICD10: F20, F51.0, G47.0] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances, including ergot alkaloid derivatives, 1- 2,5,-dimethoxy-4-iodophenyl-2-aminopropane (DOI) and lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and down-stream signaling cascades and promotes the release of Ca(2+) ions from intracellular stores. Regulates neuronal activity via the activation of short transient receptor potential calcium channels in the brain, and thereby modulates the activation of pro-opiomelacortin neurons and the release of CRH that then regulates the release of corticosterone. Plays a role in the regulation of appetite and eating behavior, responses to anxiogenic stimuli and stress. Plays a role in insulin sensitivity and glucose homeostasis.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T83813
|
||||
| UniProt ID | |||||
| Sequence |
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Lorcaserin | Drug Info | Approved | Obesity | [532210], [539956] |
| Methysergide | Drug Info | Approved | Migraine headaches | [538459], [538818] | |
| Mirtazapine | Drug Info | Approved | Depression | [536306], [542258] | |
| Nefazodone | Drug Info | Approved | Major depressive disorder | [551871] | |
| Tramadol | Drug Info | Approved | Pain | [537244], [543040] | |
| SR46349B | Drug Info | Phase 3 | Sleep initiation and maintenance disorders; Primary insomnia; Schizophrenia | [536463] | |
| VOLINANSERIN | Drug Info | Phase 3 | Discovery agent | [522480], [539159] | |
| ATHX-105 | Drug Info | Phase 2 | Obesity | [522405] | |
| Eltoprazine | Drug Info | Phase 2 | Aggressive non-hodgkin's lymphoma | [523309] | |
| PRX00933 | Drug Info | Phase 2 | Obesity; Diabetes | [551552] | |
| Puerarin | Drug Info | Phase 2 | Alcohol use disorders | [522602] | |
| Vabicaserin | Drug Info | Phase 2 | Psychotic disorders | [522459] | |
| Lorcaserin | Drug Info | Phase 1 | Drug abuse | [536710], [539956] | |
| Tedatioxetine | Drug Info | Phase 1 | Generalized anxiety disorder; Major depressive disorder | [548243] | |
| Nefazodone | Drug Info | Withdrawn from market | Depression | [536306], [542264] | |
| Deramciclane | Drug Info | Discontinued in Phase 3 | Anxiety disorder | [540889], [544913] | |
| Ritanserin | Drug Info | Discontinued in Phase 3 | Anxiety disorder | [543335], [544590] | |
| MCPP | Drug Info | Discontinued in Phase 2 | Mood disorder | [525381] | |
| R-1065 | Drug Info | Discontinued in Phase 1 | Obesity | [547560] | |
| SB-247853 | Drug Info | Discontinued in Phase 1 | Anxiety disorder | [547441] | |
| ICI-169369 | Drug Info | Terminated | Anxiety disorder | [539780], [544709] | |
| LY53857 | Drug Info | Terminated | Discovery agent | [539138], [544876] | |
| Org-37684 | Drug Info | Terminated | Anxiety disorder | [539062], [546616] | |
| Ro-60-0175 | Drug Info | Terminated | Discovery agent | [539026], [546467] | |
| SDZ-SER-082 | Drug Info | Terminated | Neurological disease | [539249], [546128] | |
| Agonist | (+)-LSD | Drug Info | [525477] | ||
| 3,4-Methylenedioxymethamphetamine | Drug Info | [551382] | |||
| 5-CT | Drug Info | [525661] | |||
| 5-HT 2c receptor agonists (obesity/schizophrenia), Galenea | Drug Info | [543963] | |||
| 5-HT2c agonists (metabolic disorders), Boehringer | Drug Info | [543963] | |||
| AL-37350A | Drug Info | [526713] | |||
| alpha-methyl-5-HT | Drug Info | [525477] | |||
| ATHX-105 | Drug Info | [544074] | |||
| BRL-15572 | Drug Info | [534475] | |||
| BW723C86 | Drug Info | [526719] | |||
| CP-809101 | Drug Info | [543963] | |||
| CSC-500297 | Drug Info | [543963] | |||
| Lorcaserin | Drug Info | [536710], [550266] | |||
| m-chlorophenylpiperazine | Drug Info | [526921] | |||
| MCPP | Drug Info | [526978], [551871] | |||
| Org 12962 | Drug Info | [527178] | |||
| Org-37684 | Drug Info | [526325] | |||
| PRX00933 | Drug Info | [551552] | |||
| R-1065 | Drug Info | [534693] | |||
| SB 216641 | Drug Info | [534475] | |||
| SB 243213 | Drug Info | [535230] | |||
| SB-247853 | Drug Info | [547442], [551871] | |||
| TFMPP | Drug Info | [525661] | |||
| TQ-1017 | Drug Info | [551871] | |||
| WAY-163909 | Drug Info | [527428] | |||
| [125I]DOI | Drug Info | [525477] | |||
| [3H]LSD | Drug Info | [543963] | |||
| Inhibitor | (+/-)-nantenine | Drug Info | [530558] | ||
| (2S)-1-(1H-furo[2,3-g]indazol-1-yl)propan-2-amine | Drug Info | [529168] | |||
| (2S)-1-(5-fluoro-1H-indazol-1-yl)propan-2-amine | Drug Info | [529168] | |||
| (2S)-1-(6-fluoro-1H-indazol-1-yl)propan-2-amine | Drug Info | [529168] | |||
| (2S)-1-(6-methoxy-1H-indazol-1-yl)propan-2-amine | Drug Info | [529168] | |||
| (E)-2-(4-fluorostyryl)-5-(phenylsulfinyl)pyridine | Drug Info | [528690] | |||
| (R,S)-1-(5-bromo-1H-indol-1-yl)propan-2-amine | Drug Info | [551219] | |||
| (R,S)-1-(5-chloro-1H-indol-1-yl)propan-2-amine | Drug Info | [551219] | |||
| (R,S)-1-(5-fluoro-1H-indol-1-yl)propan-2-amine | Drug Info | [551219] | |||
| (R,S)-1-(5-methyl-1H-indol-1-yl)propan-2-amine | Drug Info | [551219] | |||
| (R,S)-1-(6-fluoro-1H-indol-1-yl)propan-2-amine | Drug Info | [551219] | |||
| (S)-1-(5,6-difluoro-1H-indol-1-yl)propan-2-amine | Drug Info | [551219] | |||
| 1-((R)-2-aminopropyl)-1H-indazol-6-ol | Drug Info | [527952] | |||
| 1-((S)-2-aminopropyl)-1H-indazol-6-ol | Drug Info | [527952] | |||
| 1-((S)-2-aminopropyl)-7-chloro-1H-indazol-6-ol | Drug Info | [527952] | |||
| 1-((S)-2-aminopropyl)-7-fluoro-1H-indazol-6-ol | Drug Info | [527952] | |||
| 1-((S)-2-aminopropyl)-7-iodo-1H-indazol-6-ol | Drug Info | [527952] | |||
| 1-((S)-2-aminopropyl)-7-methyl-1H-indazol-6-ol | Drug Info | [527952] | |||
| 1-(2-aminoethyl)-1H-indazol-6-ol | Drug Info | [527952] | |||
| 1-(2-Dimethylamino-ethyl)-1H-indol-4-ol | Drug Info | [527668] | |||
| 1-(piperazin-1-yl)isoquinoline | Drug Info | [530516] | |||
| 1-Butyl-3-(2-dimethylamino-ethyl)-1H-indol-4-ol | Drug Info | [527668] | |||
| 2-(5-Methoxy-1H-indol-3-yl)-1-methyl-ethylamine | Drug Info | [527952] | |||
| 2-(piperazin-1-yl)-5,6,7,8-tetrahydroquinoline | Drug Info | [530516] | |||
| 3-(2-Amino-propyl)-1H-indol-5-ol | Drug Info | [527952] | |||
| 3-(2-Dimethylamino-ethyl)-1-methyl-1H-indol-4-ol | Drug Info | [527668] | |||
| 3-(2-Dimethylamino-ethyl)-1H-indol-6-ol | Drug Info | [527668] | |||
| 3-(2-Dimethylamino-ethyl)-2-methyl-1H-indol-4-ol | Drug Info | [527668] | |||
| 3-(2-Dimethylamino-propyl)-1H-indol-4-ol | Drug Info | [527668] | |||
| 3-(2-Pyrrolidin-1-yl-ethyl)-1H-indol-4-ol | Drug Info | [527668] | |||
| 3-(3-Dimethylamino-propyl)-1H-indol-4-ol | Drug Info | [527668] | |||
| 3-Dimethylaminomethyl-1-methyl-1H-indol-4-ol | Drug Info | [527668] | |||
| 3-Dimethylaminomethyl-1H-indol-4-ol | Drug Info | [527668] | |||
| 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [531079] | |||
| 4-(piperazin-1-yl)-7H-pyrrolo[2,3-d]pyrimidine | Drug Info | [530516] | |||
| 4-(piperazin-1-yl)furo[3,2-c]pyridine | Drug Info | [530516] | |||
| 4-(piperazin-1-yl)thieno[2,3-d]pyrimidine | Drug Info | [530516] | |||
| 4-(piperazin-1-yl)thieno[3,2-c]pyridine | Drug Info | [530516] | |||
| 4-(piperazin-1-yl)thieno[3,2-d]pyrimidine | Drug Info | [530516] | |||
| 5,6-dichloro-3,4-dihydroquinazolin-2-amine | Drug Info | [529148] | |||
| 5-chloro-3,4-dihydroquinazolin-2-amine | Drug Info | [529148] | |||
| 5-chloro-4-ethyl-3,4-dihydroquinazolin-2-amine | Drug Info | [529148] | |||
| 5-chloro-4-methyl-3,4-dihydroquinazolin-2-amine | Drug Info | [529148] | |||
| 5-chloro-N-(pyridin-3-yl)indoline-1-carboxamide | Drug Info | [551219] | |||
| 5-MEO-DMT | Drug Info | [527952] | |||
| 6,7-dichloro-2,3,4,5-tetrahydro-1H-3-benzazepine | Drug Info | [529221] | |||
| 6-(piperazin-1-yl)-9-propyl-9H-purine | Drug Info | [530516] | |||
| 6-bromo-2'-de-N-methylaplysinopsin | Drug Info | [526321] | |||
| 6-bromo-8-(piperazin-1-yl)imidazo[1,2-a]pyrazine | Drug Info | [530516] | |||
| 6-bromoaplysinopsin | Drug Info | [526321] | |||
| 6-chloro-N-(pyridin-3-yl)indoline-1-carboxamide | Drug Info | [551219] | |||
| 6-methyl-4-(piperazin-1-yl)furo[2,3-d]pyrimidine | Drug Info | [530516] | |||
| 7,8,9,10-tetrahydro-6H-furo-[2,3-g][3]benzazepine | Drug Info | [529221] | |||
| 7,8,9,10-tetrahydro-6H-furo-[3,2-g][3]benzazepine | Drug Info | [529221] | |||
| 8-methoxy-4-methyl-3,4-dihydroquinazolin-2-amine | Drug Info | [529148] | |||
| APLYSINOPSIN | Drug Info | [551219] | |||
| BARETTIN | Drug Info | [528498] | |||
| CHLOROPHENYLPIPERAZINE | Drug Info | [530589] | |||
| Cyclo[(6-bromotryptophan)arginine] | Drug Info | [528498] | |||
| N-(6-phenoxypyridin-3-yl)-1H-indole-3-carboxamide | Drug Info | [529582] | |||
| N-(pyridin-3-yl)indoline-1-carboxamide | Drug Info | [551219] | |||
| N-3'-ethylaplysinopsin | Drug Info | [526321] | |||
| OCTOCLOTHEPIN | Drug Info | [531171] | |||
| PG-01037 | Drug Info | [528974] | |||
| Ro-60-0175 | Drug Info | [529168] | |||
| RS-102,221 | Drug Info | [529789] | |||
| SB-271046 | Drug Info | [529191] | |||
| SEROTONIN | Drug Info | [528498] | |||
| VER-2692 | Drug Info | [527833] | |||
| VER-3323 | Drug Info | [527037] | |||
| VER-5384 | Drug Info | [527037] | |||
| VER-5593 | Drug Info | [527037] | |||
| VOLINANSERIN | Drug Info | [530936] | |||
| WAY-208466 | Drug Info | [530209] | |||
| WAY-466 | Drug Info | [527381] | |||
| YM-348 | Drug Info | [529221] | |||
| [2-(4-Fluoro-1H-indol-3-yl)-ethyl]-dimethyl-amine | Drug Info | [527668] | |||
| Antagonist | BVT 933 | Drug Info | [537068] | ||
| cyamemazine | Drug Info | [526510] | |||
| EGIS-7625 | Drug Info | [527053] | |||
| Eltoprazine | Drug Info | [551057] | |||
| FR260010 | Drug Info | [528502] | |||
| LY334362 | Drug Info | [534232] | |||
| LY53857 | Drug Info | [535896], [535927], [536352], [538142] | |||
| metergoline | Drug Info | [527178] | |||
| Methysergide | Drug Info | [536315], [536392], [536679], [538142] | |||
| Mirtazapine | Drug Info | [536175], [536571] | |||
| MPDT | Drug Info | [525722] | |||
| Nefazodone | Drug Info | [536175], [536286] | |||
| norfluoxetine | Drug Info | [525929] | |||
| Ritanserin | Drug Info | [536044], [536656], [536734], [536787] | |||
| SB 204741 | Drug Info | [527178] | |||
| SB 215505 | Drug Info | [525458] | |||
| SB 221284 | Drug Info | [527178] | |||
| SB 228357 | Drug Info | [525730] | |||
| SB 242084 | Drug Info | [534428] | |||
| spiramide | Drug Info | [527178] | |||
| [3H]mesulergine | Drug Info | [525477] | |||
| Modulator | Deramciclane | Drug Info | [534609] | ||
| ICI-169369 | Drug Info | ||||
| MK-212 | Drug Info | ||||
| Puerarin | Drug Info | ||||
| SDZ-SER-082 | Drug Info | ||||
| SR46349B | Drug Info | ||||
| Tedatioxetine | Drug Info | [1572591] | |||
| Tramadol | Drug Info | [527050] | |||
| Vabicaserin | Drug Info | [531390] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Calcium signaling pathway | ||||
| Neuroactive ligand-receptor interaction | |||||
| Gap junction | |||||
| Serotonergic synapse | |||||
| Inflammatory mediator regulation of TRP channels | |||||
| PANTHER Pathway | 5HT2 type receptor mediated signaling pathway | ||||
| Reactome | Serotonin receptors | ||||
| G alpha (q) signalling events | |||||
| WikiPathways | Serotonin Receptor 2 and ELK-SRF/GATA4 signaling | ||||
| Monoamine GPCRs | |||||
| GPCRs, Class A Rhodopsin-like | |||||
| Gastrin-CREB signalling pathway via PKC and MAPK | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| References | |||||
| Ref 522405 | ClinicalTrials.gov (NCT00735683) A Short-Term Study to Examine the Effects of ATHX-105 Phosphate on Weight Loss and Safety. U.S. National Institutes of Health. | ||||
| Ref 522459 | ClinicalTrials.gov (NCT00768612) Study Evaluating Safety and Tolerability of Vabicaserin in Patients With Sudden Worsening of Schizophrenia. U.S. National Institutes of Health. | ||||
| Ref 522480 | ClinicalTrials.gov (NCT00788515) Comparison of Volinanserin and Lormetazepam in the Treatment of Insomnia Characterized by Sleep Maintenance Difficulties. U.S. National Institutes of Health. | ||||
| Ref 522602 | ClinicalTrials.gov (NCT00854724) Puerarin Effects on Alcohol Drinking. U.S. National Institutes of Health. | ||||
| Ref 523309 | ClinicalTrials.gov (NCT01266174) Effects of Eltoprazine on Cognitive Impairment Associated With Schizophrenia (CIAS) in Adults. U.S. National Institutes of Health. | ||||
| Ref 525381 | Dopaminergic mechanisms of reinstatement of MDMA-seeking behaviour in rats. Br J Pharmacol. 2011 Apr;162(8):1770-80. | ||||
| Ref 536463 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31. | ||||
| Ref 537244 | Local effect of tramadol on formalin evoked flinching behavior in rats. Rev Bras Anestesiol. 2008 Jul-Aug;58(4):375-9, 371-5. | ||||
| Ref 538459 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 012516. | ||||
| Ref 538818 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 134). | ||||
| Ref 539026 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 166). | ||||
| Ref 539062 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 171). | ||||
| Ref 539138 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 183). | ||||
| Ref 539159 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 185). | ||||
| Ref 539249 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 195). | ||||
| Ref 539780 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 273). | ||||
| Ref 539956 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2941). | ||||
| Ref 540889 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5490). | ||||
| Ref 542258 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7241). | ||||
| Ref 542264 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7247). | ||||
| Ref 543040 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8286). | ||||
| Ref 543335 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 97). | ||||
| Ref 544590 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000237) | ||||
| Ref 544709 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000690) | ||||
| Ref 544876 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001395) | ||||
| Ref 544913 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001479) | ||||
| Ref 546128 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006463) | ||||
| Ref 546467 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008324) | ||||
| Ref 546616 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009204) | ||||
| Ref 547441 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016366) | ||||
| Ref 547560 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017316) | ||||
| Ref 525458 | Attenuation of haloperidol-induced catalepsy by a 5-HT2C receptor antagonist. Br J Pharmacol. 1999 Feb;126(3):572-4. | ||||
| Ref 525477 | High-affinity agonist binding correlates with efficacy (intrinsic activity) at the human serotonin 5-HT2A and 5-HT2C receptors: evidence favoring the ternary complex and two-state models of agonist action. J Neurochem. 1999 May;72(5):2127-34. | ||||
| Ref 525661 | Agonist high and low affinity state ratios predict drug intrinsic activity and a revised ternary complex mechanism at serotonin 5-HT(2A) and 5-HT(2C) receptors. Synapse. 2000 Feb;35(2):144-50. | ||||
| Ref 525722 | 2-Substituted tryptamines: agents with selectivity for 5-HT(6) serotonin receptors. J Med Chem. 2000 Mar 9;43(5):1011-8. | ||||
| Ref 525730 | Biarylcarbamoylindolines are novel and selective 5-HT(2C) receptor inverse agonists: identification of 5-methyl-1-[[2-[(2-methyl-3-pyridyl)oxy]- 5-pyridyl]carbamoyl]-6-trifluoromethylindoline (SB-243213) as a potential antidepressant/anxiolytic agent. J Med Chem. 2000 Mar 23;43(6):1123-34. | ||||
| Ref 525929 | Evidence for possible involvement of 5-HT(2B) receptors in the cardiac valvulopathy associated with fenfluramine and other serotonergic medications. Circulation. 2000 Dec 5;102(23):2836-41. | ||||
| Ref 526321 | J Nat Prod. 2002 Apr;65(4):476-80.New antiinfective and human 5-HT2 receptor binding natural and semisynthetic compounds from the Jamaican sponge Smenospongia aurea. | ||||
| Ref 526325 | Role of 5-hT2C receptors in the hypophagic effect of m-CPP, ORG 37684 and CP-94,253 in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2002 Apr;26(3):441-9. | ||||
| Ref 526510 | Affinity of cyamemazine, an anxiolytic antipsychotic drug, for human recombinant dopamine vs. serotonin receptor subtypes. Biochem Pharmacol. 2003 Feb 1;65(3):435-40. | ||||
| Ref 526713 | J Med Chem. 2003 Sep 11;46(19):4188-95.A novel and selective 5-HT2 receptor agonist with ocular hypotensive activity: (S)-(+)-1-(2-aminopropyl)-8,9-dihydropyrano[3,2-e]indole. | ||||
| Ref 526719 | Agonist actions of dihydroergotamine at 5-HT2B and 5-HT2C receptors and their possible relevance to antimigraine efficacy. Br J Pharmacol. 2003 Sep;140(2):277-84. Epub 2003 Aug 11. | ||||
| Ref 526921 | Pharmacological profile of YM348, a novel, potent and orally active 5-HT2C receptor agonist. Eur J Pharmacol. 2004 Jan 1;483(1):37-43. | ||||
| Ref 526978 | mCPP-induced hyperactivity in 5-HT2C receptor mutant mice is mediated by activation of multiple 5-HT receptor subtypes. Neuropharmacology. 2004 Apr;46(5):663-71. | ||||
| Ref 527037 | Bioorg Med Chem Lett. 2004 May 3;14(9):2367-70.Indoline derivatives as 5-HT(2C) receptor agonists. | ||||
| Ref 527050 | The inhibitory effects of tramadol on 5-hydroxytryptamine type 2C receptors expressed in Xenopus oocytes. Anesth Analg. 2004 May;98(5):1401-6, table of contents. | ||||
| Ref 527053 | Effects of EGIS-7625, a selective and competitive 5-HT2B receptor antagonist. Cardiovasc Drugs Ther. 2003 Sep-Nov;17(5-6):427-34. | ||||
| Ref 527178 | Pharmacological characterisation of the agonist radioligand binding site of 5-HT(2A), 5-HT(2B) and 5-HT(2C) receptors. Naunyn Schmiedebergs Arch Pharmacol. 2004 Aug;370(2):114-23. Epub 2004 Jul 30. | ||||
| Ref 527381 | J Med Chem. 2005 Jan 27;48(2):353-6.Discovery of 5-arylsulfonamido-3-(pyrrolidin-2-ylmethyl)-1H-indole derivatives as potent, selective 5-HT6 receptor agonists and antagonists. | ||||
| Ref 527428 | WAY-163909 [(7bR, 10aR)-1,2,3,4,8,9,10,10a-octahydro-7bH-cyclopenta-[b][1,4]diazepino[6,7,1hi]indole], a novel 5-hydroxytryptamine 2C receptor-selective agonist with anorectic activity. J Pharmacol Exp Ther. 2005 May;313(2):862-9. Epub 2005 Feb 10. | ||||
| Ref 527668 | Bioorg Med Chem Lett. 2005 Oct 15;15(20):4555-9.SAR of psilocybin analogs: discovery of a selective 5-HT 2C agonist. | ||||
| Ref 527833 | Bioorg Med Chem Lett. 2006 Feb;16(3):677-80. Epub 2005 Oct 27.Pyrrolo(iso)quinoline derivatives as 5-HT(2C) receptor agonists. | ||||
| Ref 527952 | J Med Chem. 2006 Jan 12;49(1):318-28.1-((S)-2-aminopropyl)-1H-indazol-6-ol: a potent peripherally acting 5-HT2 receptor agonist with ocular hypotensive activity. | ||||
| Ref 528498 | J Nat Prod. 2006 Oct;69(10):1421-4.Brominated cyclodipeptides from the marine sponge Geodia barretti as selective 5-HT ligands. | ||||
| Ref 528502 | Anxiolytic activity of a novel potent serotonin 5-HT2C receptor antagonist FR260010: a comparison with diazepam and buspirone. Eur J Pharmacol. 2006 Dec 28;553(1-3):171-84. Epub 2006 Sep 28. | ||||
| Ref 528690 | Bioorg Med Chem Lett. 2007 May 1;17(9):2643-8. Epub 2007 Feb 2.2,5-Disubstituted pyridines: the discovery of a novel series of 5-HT2A ligands. | ||||
| Ref 528974 | J Med Chem. 2007 Aug 23;50(17):4135-46. Epub 2007 Aug 2.Heterocyclic analogues of N-(4-(4-(2,3-dichlorophenyl)piperazin-1-yl)butyl)arylcarboxamides with functionalized linking chains as novel dopamine D3 receptor ligands: potential substance abuse therapeutic agents. | ||||
| Ref 529148 | Bioorg Med Chem Lett. 2008 Jan 1;18(1):256-61. Epub 2007 Oct 30.Cyclic guanidines as dual 5-HT5A/5-HT7 receptor ligands: structure-activity relationship elucidation. | ||||
| Ref 529168 | Bioorg Med Chem. 2008 Feb 15;16(4):1966-82. Epub 2007 Nov 4.Synthesis and structure-activity relationships of a series of substituted 2-(1H-furo[2,3-g]indazol-1-yl)ethylamine derivatives as 5-HT2C receptor agonists. | ||||
| Ref 529191 | Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43. Epub 2007 Nov 17.Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. | ||||
| Ref 529221 | Bioorg Med Chem. 2008 Mar 15;16(6):3309-20. Epub 2007 Dec 8.Synthesis and structure-activity relationships of a series of benzazepine derivatives as 5-HT2C receptor agonists. | ||||
| Ref 529582 | Bioorg Med Chem Lett. 2008 Jul 15;18(14):3844-7. Epub 2008 Jun 21.Synthesis and structure-activity relationship of 1H-indole-3-carboxylic acid pyridine-3-ylamides: a novel series of 5-HT2C receptor antagonists. | ||||
| Ref 529789 | J Med Chem. 2008 Nov 27;51(22):7094-8.cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain responses against carrageenan-induced hyperalgesia. | ||||
| Ref 530209 | Bioorg Med Chem. 2009 Jul 15;17(14):5153-63. Epub 2009 May 29.Novel 1-aminoethyl-3-arylsulfonyl-1H-pyrrolo[2,3-b]pyridines are potent 5-HT(6) agonists. | ||||
| Ref 530516 | Bioorg Med Chem Lett. 2010 Jan 1;20(1):266-71. Epub 2009 Oct 30.Design and synthesis of orally-active and selective azaindane 5HT2c agonist for the treatment of obesity. | ||||
| Ref 530558 | Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. | ||||
| Ref 530589 | Bioorg Med Chem Lett. 2010 Feb 1;20(3):1128-33. Epub 2009 Dec 6.Tricyclic dihydroquinazolinones as novel 5-HT2C selective and orally efficacious anti-obesity agents. | ||||
| Ref 530936 | Bioorg Med Chem Lett. 2010 Jun 15;20(12):3708-12. Epub 2010 Apr 24.Non-basic ligands for aminergic GPCRs: the discovery and development diaryl sulfones as selective, orally bioavailable 5-HT2A receptor antagonists for the treatment of sleep disorders. | ||||
| Ref 531079 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
| Ref 531171 | J Med Chem. 2010 Oct 14;53(19):7021-34.Exploring the neuroleptic substituent in octoclothepin: potential ligands for positron emission tomography with subnanomolar affinity for |A(1)-adrenoceptors. | ||||
| Ref 531390 | Characterization of vabicaserin (SCA-136), a selective 5-hydroxytryptamine 2C receptor agonist. J Pharmacol Exp Ther. 2011 Jun;337(3):673-80. | ||||
| Ref 534232 | A novel class of 5-HT2A receptor antagonists: aryl aminoguanidines. Life Sci. 1996;59(15):1259-68. | ||||
| Ref 534428 | SB 242084, a selective and brain penetrant 5-HT2C receptor antagonist. Neuropharmacology. 1997 Apr-May;36(4-5):609-20. | ||||
| Ref 534475 | SB-216641 and BRL-15572--compounds to pharmacologically discriminate h5-HT1B and h5-HT1D receptors. Naunyn Schmiedebergs Arch Pharmacol. 1997 Sep;356(3):312-20. | ||||
| Ref 534609 | Deramciclane, a putative anxiolytic drug, is a serotonin 5-HT2C receptor inverse agonist but fails to induce 5-HT2C receptor down-regulation. Psychopharmacology (Berl). 1998 Mar;136(2):99-104. | ||||
| Ref 534693 | Antiaversive effects of 5HT2C receptor agonists and fluoxetine in a model of panic-like anxiety in rats. Eur Neuropsychopharmacol. 1998 Aug;8(3):161-8. | ||||
| Ref 535230 | SB-243213; a selective 5-HT2C receptor inverse agonist with improved anxiolytic profile: lack of tolerance and withdrawal anxiety. Neuropharmacology. 2001 Aug;41(2):186-99. | ||||
| Ref 535896 | The fenfluramine metabolite (+)-norfenfluramine is vasoactive. J Pharmacol Exp Ther. 2004 May;309(2):845-52. Epub 2004 Jan 29. | ||||
| Ref 535927 | Some studies on the 5-hydroxytryptamine receptors in the isolated rat uterus. Afr J Med Med Sci. 2002 Dec;31(4):361-5. | ||||
| Ref 536044 | Combined treatment of portal hypertension with ritanserin and propranolol in conscious and unrestrained cirrhotic rats. Hepatology. 1992 May;15(5):878-82. | ||||
| Ref 536175 | Serotonin 5-HT2C receptors as a target for the treatment of depressive and anxious states: focus on novel therapeutic strategies. Therapie. 2005 Sep-Oct;60(5):441-60. | ||||
| Ref 536286 | Serotonin reuptake inhibitors: the corner stone in treatment of depression for half a century--a medicinal chemistry survey. Curr Top Med Chem. 2006;6(17):1801-23. | ||||
| Ref 536315 | Serotonergic mechanisms of the lateral parabrachial nucleus in renal and hormonal responses to isotonic blood volume expansion. Am J Physiol Regul Integr Comp Physiol. 2007 Mar;292(3):R1190-7. Epub 2006 Nov 30. | ||||
| Ref 536352 | The 5-hydroxytryptamine2A receptor is involved in (+)-norfenfluramine-induced arterial contraction and blood pressure increase in deoxycorticosterone acetate-salt hypertension. J Pharmacol Exp Ther. 2007 May;321(2):485-91. Epub 2007 Feb 8. | ||||
| Ref 536392 | Intake of fermented soybean (natto) increased locomotor activity in mice. Biol Pharm Bull. 2007 Apr;30(4):845-6. | ||||
| Ref 536571 | Inverse agonist and neutral antagonist actions of antidepressants at recombinant and native 5-hydroxytryptamine2C receptors: differential modulation of cell surface expression and signal transduction. Mol Pharmacol. 2008 Mar;73(3):748-57. Epub 2007 Dec 14. | ||||
| Ref 536656 | Effects of antipsychotics and reference monoaminergic ligands on marble burying behavior in mice. Behav Pharmacol. 2008 Mar;19(2):145-52. | ||||
| Ref 536679 | Spinal serotonin receptor activation modulates the exercise ventilatory response with increased dead space in goats. Respir Physiol Neurobiol. 2008 May 31;161(3):230-8. Epub 2008 Feb 29. | ||||
| Ref 536734 | Hypersensitivity of 5-HT2 receptors in OCD patients. An increased prolactin response after a challenge with meta-chlorophenylpiperazine and pre-treatment with ritanserin and placebo. J Psychiatr Res.2008 Sep;42(11):894-901. Epub 2008 Jun 3. | ||||
| Ref 536787 | Characterization of contractile 5-hydroxytryptamine receptor subtypes in the in situ autoperfused kidney in the anaesthetized rat. Eur J Pharmacol. 2008 Sep 11;592(1-3):133-7. Epub 2008 Jul 4. | ||||
| Ref 538142 | p-Chloroamphetamine, a serotonin-releasing drug, elicited in rats a hyperglycemia mediated by the 5-HT1A and 5-HT2B/2C receptors. Eur J Pharmacol. 1998 Oct 23;359(2-3):185-90. | ||||
| Ref 543963 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 8). | ||||
| Ref 544074 | Pharmacological targeting of the serotonergic system for the treatment of obesity. J Physiol. 2009 January 1; 587(Pt 1): 49-60. | ||||
| Ref 547442 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016366) | ||||
| Ref 550266 | Clinical pipeline report, company report or official report of Arena Pharmaceuticals (2011). | ||||
| Ref 551219 | Synthesis and structure-affinity relationships of novel small molecule natural product derivatives capable of discriminating between serotonin 5-HT1A, 5-HT2A, 5-HT2C receptor subtypes. Bioorg Med Chem. 2010 Jul 1;18(13):4783-92. doi: 10.1016/j.bmc.2010.05.017. Epub 2010 May 15. | ||||
| Ref 551382 | The origin of <span class="caps">MDMA</span> (ecstasy) revisited: the true story reconstructed from the original documents. Addiction. 2006 Sep;101(9):1241-5. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.