Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T67162
|
||||
| Former ID |
TTDS00012
|
||||
| Target Name |
D(2) dopamine receptor
|
||||
| Gene Name |
DRD2
|
||||
| Synonyms |
Dopamine D2 receptor; Dopamine receptor 2; DRD2
|
||||
| Target Type |
Successful
|
||||
| Disease | Alcohol use disorders [ICD9: 303; ICD10: F10.2] | ||||
| Allergy [ICD9: 995.3; ICD10: T78.4] | |||||
| Asthma; Bronchitis [ICD9: 466, 490, 491, 493; ICD10: J20-J21, J42, J45] | |||||
| Alzheimer disease [ICD9: 331; ICD10: G30] | |||||
| Advanced stage Parkinson's disease [ICD9: 332; ICD10: F02.3, G20] | |||||
| Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42] | |||||
| Bipolar disorder [ICD9: 296.0, 296.1, 296.4, 296.5, 296.6, 296.7, 296.8, 300; ICD10: F31, F40-F42] | |||||
| Bipolar disorder; Schizophrenia [ICD9:296.0, 296.1, 296.4, 296.5, 296.6, 296.7, 296.8, 300, 295; ICD10: F31, F40-F42, F20] | |||||
| Breast cancer [ICD9: 174, 175; ICD10: C50] | |||||
| Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | |||||
| Cardiac failure [ICD10: I50] | |||||
| Cardiotonic [ICD10: I50] | |||||
| Cerebrovascular ischaemia [ICD9: 434.91; ICD10: I61-I63] | |||||
| Carcinoid syndrome; Acromegaly [ICD9:253; ICD10: E34.0, E22.0] | |||||
| Chronic obstructive pulmonary disease [ICD9: 490-492, 494-496; ICD10: J40-J44, J47] | |||||
| Corneal vascularity; Hyperaemia; Itching [ICD10: L29] | |||||
| Depressive fatigue [ICD9: 780.71; ICD10: R53.82] | |||||
| Dermal necrosis [ICD10: K05] | |||||
| Emesis [ICD9: 787; ICD10: R11] | |||||
| Fibrosis [ICD9: 709.2; ICD10: L90.5] | |||||
| False perceptions; Bipolar disorder [ICD9:297, 780.1, 296.0, 296.1, 296.4, 296.5, 296.6, 296.7, 296.8, 300; ICD10: F22, R44, F31, F40-F42] | |||||
| Gastrointestinal problems [ICD9: 536, 750; ICD10: K30-K31, Q40-Q41] | |||||
| Glaucoma [ICD9: 365; ICD10: H40-H42] | |||||
| Hypotension [ICD9: 458, 796.3; ICD10: I95] | |||||
| Hypertension [ICD9: 401; ICD10: I10-I16] | |||||
| Hyperprolactinemia [ICD9: 253.1; ICD10: E22.1] | |||||
| Heart failure [ICD9: 428; ICD10: I50] | |||||
| Hypertension; Angina pectoris [ICD9:401, 413; ICD10: I10-I16, I20] | |||||
| Huntington's disease [ICD9: 294.1, 333.4; ICD10: F02.2, G10] | |||||
| Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
| Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51] | |||||
| Idiopathic thrombocytopenic purpura [ICD9: 287.31; ICD10: D69.3] | |||||
| Insomnia [ICD9: 307.41, 307.42, 327.0, 780.51, 780.52; ICD10: F51.0, G47.0] | |||||
| Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32] | |||||
| Malignant phaeochromocytoma; Benign prostatic hypertrophy; Malignant essential hypertension [ICD10: N40, C61] | |||||
| Migraine headaches [ICD9: 346; ICD10: G43] | |||||
| Maintain blood pressure in hypotensive states [ICD10: I10] | |||||
| Nausea; Vomiting [ICD9: 787, 787.0; ICD10: R11] | |||||
| Nasal congestion [ICD9: 478.19; ICD10: J34.89] | |||||
| Non-small cell lung cancer [ICD10: C33-C34] | |||||
| Ophthalmic disease [ICD10: H00-H59] | |||||
| Peripheral vasoconstriction; Pulmonary hypertension [ICD9:443, 416; ICD10: I73, I27.0, I27.2] | |||||
| Postpartum haemorrhage [ICD9: 666; ICD10: O72] | |||||
| Psychosis [ICD10: F20-F29] | |||||
| Psychotic disorders [ICD9: 290-299; ICD10: F20-F29] | |||||
| Pain; Inflammatory diseases [ICD9: 338,780; ICD10: R52, G89] | |||||
| Parkinson's disease; Restless legs syndrome [ICD9: 332, 333.94; ICD10: F02.3, G20, G25.8] | |||||
| Psychiatric disorder [ICD9: 290-319; ICD10: F01-F99] | |||||
| Parkinson's disease [ICD9: 332; ICD10: G20] | |||||
| Schizophrenia [ICD9: 295; ICD10: F20] | |||||
| Schizophrenia; Bipolar disorder [ICD9: 295, 296; ICD10: F20, F31] | |||||
| Schizophrenia; Schizoaffective disorders [ICD9: 295, 295.70; ICD10: F20, F25] | |||||
| Substance dependence [ICD10: F10-F19] | |||||
| Schizoaffective disorder; Schizophrenia [ICD9: 295, 295.70; ICD10: F20, F25] | |||||
| Sexual dysfunction [ICD9: 302.7; ICD10: F52] | |||||
| Function |
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T67162
|
||||
| UniProt ID | |||||
| Sequence |
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA VNPIIYTTFNIEFRKAFLKILHC |
||||
| Structure |
1I15; 2YOU
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Acetophenazine | Drug Info | Approved | False perceptions; Bipolar disorder | [538457], [551871] |
| Amisulpride | Drug Info | Approved | Schizophrenia | [536361], [543330] | |
| Aniracetam | Drug Info | Approved | Cerebrovascular ischaemia | [467478], [526084] | |
| Apomorphine | Drug Info | Approved | Parkinson's disease | [525056], [540260] | |
| Aripiprazole | Drug Info | Approved | Schizophrenia | [537632], [540346] | |
| Bevantolol | Drug Info | Approved | Hypertension; Angina pectoris | [536361], [551871] | |
| Bromocriptine | Drug Info | Approved | Parkinson's disease | [536285], [540438] | |
| Cabergoline | Drug Info | Approved | Hyperprolactinemia | [536285], [540505] | |
| Cariprazine | Drug Info | Approved | Bipolar disorder | [532651], [542650] | |
| Carphenazine | Drug Info | Approved | Insomnia | [551871] | |
| Chlorpromazine | Drug Info | Approved | Schizophrenia | [538339], [543051] | |
| Chlorprothixene | Drug Info | Approved | Psychotic disorders | [538474] | |
| Dapiprazole | Drug Info | Approved | Glaucoma | [551871] | |
| Denopamine | Drug Info | Approved | Cardiotonic | [540779], [551871] | |
| Dihydroergotamine | Drug Info | Approved | Migraine headaches | [537885], [538723] | |
| Dihydroergotoxine | Drug Info | Approved | Alzheimer disease | [534844] | |
| Docarpamine | Drug Info | Approved | Hypertension | [551871] | |
| Domperidone | Drug Info | Approved | Gastrointestinal problems | [536732], [543331] | |
| Dopamine | Drug Info | Approved | Parkinson's disease | [536463], [543313] | |
| Dopexamine | Drug Info | Approved | Cardiac failure | [551871] | |
| Droperidol | Drug Info | Approved | Nausea; Vomiting | [538243], [542182] | |
| Ephedrine | Drug Info | Approved | Asthma; Bronchitis | [536322], [540937] | |
| Ergonovine | Drug Info | Approved | Postpartum haemorrhage | [538389], [538934] | |
| Fluspirilene | Drug Info | Approved | Schizophrenia | [543173], [550728] | |
| Haloperidol | Drug Info | Approved | Schizophrenia | [536361], [543216] | |
| Ibopamine hci | Drug Info | Approved | Cardiotonic | [551871] | |
| Iloperidone | Drug Info | Approved | Schizophrenia | [530677], [543255] | |
| Levodopa | Drug Info | Approved | Parkinson's disease | [540492] | |
| Levomepromazine | Drug Info | Approved | Psychosis | [551871] | |
| Lisuride | Drug Info | Approved | Parkinson's disease | [467639], [536217] | |
| Loxapine | Drug Info | Approved | Schizophrenia | [551871] | |
| Lurasidone hydrochloride | Drug Info | Approved | Schizophrenia | [530859], [531351], [542486], [551871] | |
| Mephentermine | Drug Info | Approved | Maintain blood pressure in hypotensive states | [551871] | |
| Mesoridazine | Drug Info | Approved | Schizophrenia | [538478], [542242] | |
| Metaraminol | Drug Info | Approved | Hypotension | [538343], [542244] | |
| Methamfetamine | Drug Info | Approved | Pain; Inflammatory diseases | [536103] | |
| Methyldopa | Drug Info | Approved | Hypertension | [468270], [538218] | |
| Metoclopramide | Drug Info | Approved | Nausea; Vomiting | [538220], [539539] | |
| Molindone | Drug Info | Approved | Schizophrenia | [538485], [539311] | |
| N-0923 | Drug Info | Approved | Parkinson's disease | [528061], [529282] | |
| Naphazoline | Drug Info | Approved | Corneal vascularity; Hyperaemia; Itching | [551871] | |
| Nemonapride | Drug Info | Approved | Schizophrenia | [536463], [543347] | |
| Olanzapine | Drug Info | Approved | Schizophrenia | [467939], [535119] | |
| OPC-34712 | Drug Info | Approved | Major depressive disorder | [523551], [542651] | |
| PD-172760 | Drug Info | Approved | Schizophrenia | [536463] | |
| Perazine | Drug Info | Approved | Psychotic disorders | [551871] | |
| Pergolide | Drug Info | Approved | Parkinson's disease | [468029], [536285] | |
| Perphenazine | Drug Info | Approved | Schizophrenia; Bipolar disorder | [539323], [549998] | |
| Phenoxybenzamine | Drug Info | Approved | Malignant phaeochromocytoma; Benign prostatic hypertrophy; Malignant essential hypertension | [551871] | |
| Phentolamine | Drug Info | Approved | Dermal necrosis | [468130], [538172] | |
| Phenylephrine | Drug Info | Approved | Ophthalmic disease | [468078], [538192] | |
| Phenyltoloxamine | Drug Info | Approved | Allergy | [551871] | |
| Pimozide | Drug Info | Approved | Schizophrenia | [538488], [543290] | |
| Piperacetazine | Drug Info | Approved | Schizophrenia | [551871] | |
| Pramipexole | Drug Info | Approved | Parkinson's disease | [536580], [543322] | |
| Prochlorperazine | Drug Info | Approved | Nausea; Vomiting | [538160], [542299] | |
| Pseudoephedrine | Drug Info | Approved | Nasal congestion | [538291], [542306] | |
| Quetiapine | Drug Info | Approved | Schizophrenia | [468121], [536773] | |
| Quinagolide | Drug Info | Approved | Hyperprolactinemia | [536361] | |
| Risperidone | Drug Info | Approved | Schizophrenia | [536526], [543327] | |
| Ropinirole | Drug Info | Approved | Parkinson's disease | [537532], [542315] | |
| Sulpiride | Drug Info | Approved | Schizophrenia | [537476], [543328] | |
| Thiethylperazine | Drug Info | Approved | Nausea; Vomiting | [538460], [542328] | |
| Thioridazine | Drug Info | Approved | Schizophrenia | [538368], [538609] | |
| Thiothixene | Drug Info | Approved | Schizophrenia | [538226], [539343] | |
| Tiapride | Drug Info | Approved | Alcohol use disorders | [551871] | |
| Tolazoline | Drug Info | Approved | Peripheral vasoconstriction; Pulmonary hypertension | [538395], [542333], [551871] | |
| Ziprasidone | Drug Info | Approved | Schizophrenia | [536526], [541192] | |
| Zuclopenthixol | Drug Info | Approved | Schizophrenia | [542559], [550679] | |
| Raclopride | Drug Info | Phase 4 | Psychotic disorders | [524579], [543312] | |
| Talipexole | Drug Info | Phase 4 | Discovery agent | [524901], [540844] | |
| Bis(olanzapine) pamoate monohydrate | Drug Info | Phase 3 | Psychotic disorders | [551871] | |
| Blonanserin | Drug Info | Phase 3 | Schizophrenia | [536463], [542649] | |
| CQA 206-291 | Drug Info | Phase 3 | Parkinson's disease | [531697] | |
| Entacapone+levodopa+carbidopa | Drug Info | Phase 3 | Parkinson's disease; Restless legs syndrome | [544058] | |
| Lisuride | Drug Info | Phase 3 | Fibrosis | [521931] | |
| Pridopidine | Drug Info | Phase 3 | Huntington's disease | [522303] | |
| RBP-7000 | Drug Info | Phase 3 | Non-small cell lung cancer | [524709] | |
| Sumanirole | Drug Info | Phase 3 | Parkinson's disease | [536923], [540570] | |
| Zicronapine | Drug Info | Phase 3 | Schizophrenia | [523357] | |
| P2B-001 | Drug Info | Phase 2/3 | Parkinson's disease | [524487] | |
| APD-403 | Drug Info | Phase 2 | Emesis | [524298] | |
| Aplindore fumarate | Drug Info | Phase 2 | Schizophrenia | [536463] | |
| BIM23A760 | Drug Info | Phase 2 | Carcinoid syndrome; Acromegaly | [528145], [536738] | |
| BL-1020 | Drug Info | Phase 2 | Schizophrenia | [536463] | |
| CGS-15873A | Drug Info | Phase 2 | Psychotic disorders | [544883] | |
| CLR-3001 | Drug Info | Phase 2 | Major depressive disorder | [549113] | |
| Intranasal apomorphine | Drug Info | Phase 2 | Sexual dysfunction | [527086] | |
| JNJ-37822681 | Drug Info | Phase 2 | Schizophrenia | [522393] | |
| Mazapertine succinate | Drug Info | Phase 2 | Psychotic disorders | [534644] | |
| Ocaperidone | Drug Info | Phase 2 | Schizophrenia; Schizoaffective disorders | [467839], [526792], [536463] | |
| Pardoprunox | Drug Info | Phase 2 | Advanced stage Parkinson's disease | [536580] | |
| PD-143188 | Drug Info | Phase 2 | Psychotic disorders | [546028] | |
| ROXINDOLE | Drug Info | Phase 2 | Psychotic disorders | [468254], [534084] | |
| RP5063 | Drug Info | Phase 2 | Schizoaffective disorder; Schizophrenia | [523723] | |
| SDZ-MAR-327 | Drug Info | Phase 2 | Psychotic disorders | [534772], [536463] | |
| XP-21279 | Drug Info | Phase 2 | Parkinson's disease | [523123] | |
| (-)-3PPP, Maryland | Drug Info | Phase 1 | Schizophrenia | [526776] | |
| 1192U90 | Drug Info | Phase 1 | Psychotic disorders | [534252] | |
| Abaperidone | Drug Info | Phase 1 | Schizophrenia | [551815] | |
| Carmoxirole | Drug Info | Phase 1 | Hypertension | [526775] | |
| Dopamine | Drug Info | Phase 1 | Hypotension | [543313], [551871] | |
| Lu-02-750 | Drug Info | Phase 1 | Parkinson's disease | [548985] | |
| Lu-AE04621 | Drug Info | Phase 1 | Parkinson's disease | [549066] | |
| SKL-10406 | Drug Info | Phase 1 | Major depressive disorder | [549136] | |
| SSR-181507 | Drug Info | Phase 1 | Schizophrenia | [536463] | |
| Umespirone | Drug Info | Phase 1 | Anxiety disorder | [544712] | |
| YKP-1358 | Drug Info | Phase 1 | Schizophrenia; Schizoaffective disorders | [536463] | |
| D1 agonist D2 antagonist | Drug Info | Preclinical | Schizophrenia | [536463] | |
| F-15063 | Drug Info | Preclinical | Schizophrenia | [548528] | |
| Org-23366 | Drug Info | Preclinical | Schizophrenia | [536463] | |
| PD-157695 | Drug Info | Preclinical | Schizophrenia | [536463] | |
| PD-158771 | Drug Info | Preclinical | Schizophrenia | [536463] | |
| PGX-200097 | Drug Info | Preclinical | Schizophrenia | [548315] | |
| S32504 | Drug Info | Preclinical | Parkinson's disease | [526972] | |
| Carphenazine | Drug Info | Withdrawn from market | Schizophrenia | [542148], [550749] | |
| Fencamfamine | Drug Info | Withdrawn from market | Depressive fatigue | [550709] | |
| Flupenthixol | Drug Info | Withdrawn from market | Schizophrenia | [536814], [543333] | |
| Nomifensine | Drug Info | Withdrawn from market | Breast cancer | [468021], [551871] | |
| Remoxipride | Drug Info | Withdrawn from market | Schizophrenia | [526174] | |
| Sertindole | Drug Info | Withdrawn from market | Schizophrenia | [528387], [543343] | |
| (S)-amisulpride | Drug Info | Discontinued in Phase 4 | Schizophrenia | [536463] | |
| Bifeprunox | Drug Info | Discontinued in Phase 3 | Schizophrenia | [536463] | |
| Lamectacin | Drug Info | Discontinued in Phase 3 | Bacterial infections | [547323] | |
| NOLOMIROLE HYDROCHLORIDE | Drug Info | Discontinued in Phase 3 | Heart failure | [545464] | |
| Sibenadet | Drug Info | Discontinued in Phase 3 | Chronic obstructive pulmonary disease | [536661] | |
| TIOSPIRONE | Drug Info | Discontinued in Phase 3 | Discovery agent | [538617], [544679] | |
| ATI-9242 | Drug Info | Discontinued in Phase 2 | Schizophrenia | [548733] | |
| BAM-1110 | Drug Info | Discontinued in Phase 2 | Parkinson's disease | [545888] | |
| Declopramide | Drug Info | Discontinued in Phase 2 | Inflammatory bowel disease | [546239] | |
| FOSOPAMINE | Drug Info | Discontinued in Phase 2 | Hypertension | [545255] | |
| MAZAPERTINE | Drug Info | Discontinued in Phase 2 | Discovery agent | [545274] | |
| Naxagolide | Drug Info | Discontinued in Phase 2 | Parkinson's disease | [545272] | |
| PF-217830 | Drug Info | Discontinued in Phase 2 | Bipolar disorder; Schizophrenia | [548438] | |
| Romergoline | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [544873] | |
| Sarizotan | Drug Info | Discontinued in Phase 2 | Parkinson's disease | [536923] | |
| SAVOXEPIN MESYLATE | Drug Info | Discontinued in Phase 2 | Psychotic disorders | [544699] | |
| SLV-310 | Drug Info | Discontinued in Phase 2 | Schizophrenia | [536463] | |
| AM-831 | Drug Info | Discontinued in Phase 1 | Schizophrenia | [547459] | |
| DU-29894 | Drug Info | Discontinued in Phase 1 | Psychotic disorders | [544888] | |
| Ordopidine | Drug Info | Discontinued in Phase 1 | Psychotic disorders | [548392] | |
| S-18327 | Drug Info | Discontinued in Phase 1 | Psychotic disorders | [546690] | |
| SDZ-GLC-756 | Drug Info | Discontinued in Phase 1 | Glaucoma | [546521] | |
| SLV-313 | Drug Info | Discontinued in Phase 1 | Schizophrenia | [536463] | |
| 1192U90 | Drug Info | Terminated | Schizophrenia | [536463] | |
| A-80426 | Drug Info | Terminated | Discovery agent | [546043] | |
| AMR-103 | Drug Info | Terminated | Parkinson's disease | [548466] | |
| BIMG80 | Drug Info | Terminated | Psychotic disorders | [546146] | |
| CGP-25454A | Drug Info | Terminated | Major depressive disorder | [545667] | |
| CP-903397 | Drug Info | Terminated | Schizophrenia | [548436] | |
| E-2040 | Drug Info | Terminated | Schizophrenia | [546598] | |
| Etrabamine | Drug Info | Terminated | Parkinson's disease | [545467] | |
| GMC-283 | Drug Info | Terminated | Schizophrenia | [536463] | |
| HMR-2934 | Drug Info | Terminated | Schizophrenia | [536463] | |
| LY-243062 | Drug Info | Terminated | Inflammatory disease | [545858] | |
| NGD-93-1 | Drug Info | Terminated | Psychotic disorders | [545340] | |
| NNC-22-0031 | Drug Info | Terminated | Psychotic disorders | [534327] | |
| Org-10490 | Drug Info | Terminated | Psychotic disorders | [551630] | |
| PD-128483 | Drug Info | Terminated | Discovery agent | [545125] | |
| PNU-96391A | Drug Info | Terminated | Substance dependence | [532971] | |
| RWJ-25730 | Drug Info | Terminated | Psychotic disorders | [544892] | |
| S32504 | Drug Info | Terminated | Major depressive disorder | [547082] | |
| SDZ-MAR-327 | Drug Info | Terminated | Schizophrenia | [536463] | |
| SLV-307 | Drug Info | Terminated | Parkinson's disease | [551583] | |
| Y-20024 | Drug Info | Terminated | Psychotic disorders | [544868] | |
| Y-931 | Drug Info | Terminated | Schizophrenia | [536463] | |
| ZD-3638 | Drug Info | Terminated | Schizophrenia | [536463] | |
| Inhibitor | (+)-(1R,1'S)-berbamunine hydrochloride | Drug Info | [551356] | ||
| (+)-(1R,1'S)-thaligrisine hydrochloride | Drug Info | [551356] | |||
| (+)-3-(1-Propyl-piperidin-3-yl)-phenol | Drug Info | [530310] | |||
| (+)-BUTACLAMOL | Drug Info | [527368] | |||
| (+/-)-7-hydroxy-2-(N,N-di-n-propylamino)tetralin | Drug Info | [529836] | |||
| (+/-)-nantenine | Drug Info | [530558] | |||
| (-)-(1S,1'R)-O,O-dimethylgrisbine hydrochloride | Drug Info | [551356] | |||
| (-)-3-(1-Propyl-piperidin-3-yl)-benzonitrile | Drug Info | [533938] | |||
| (-)-5-hydroxy-2-(dipropylamino)tetralin | Drug Info | [530606] | |||
| (4-Ethynyl-cyclohex-3-enyl)-dipropyl-amine | Drug Info | [525701] | |||
| (4-Quinolin-2-ylpiperazin-1-yl)acetic Acid | Drug Info | [530114] | |||
| (5-Methoxy-chroman-3-yl)-dipropyl-amine | Drug Info | [534244] | |||
| (R)-(+)-coclaurine | Drug Info | [534656] | |||
| (R)-(-)-10-methyl-11-hydroxyaporphine | Drug Info | [528876] | |||
| (R)-(-)-11-hydroxy-N-n-propylnoraporphine | Drug Info | [529289] | |||
| (R)-(-)-2-methoxy-11-hydroxyaporphine | Drug Info | [529289] | |||
| (R)-(-)-2-methoxy-N-npropylnorapomorphine | Drug Info | [529289] | |||
| (R)-(-)-2-Methyl-apomorphine hydrochloride | Drug Info | [529328] | |||
| (R)-(-)-2-Phenyl-apomorphine hydrochloride | Drug Info | [529328] | |||
| (R)-(-)-N-ethyl-2-methoxy-11-hydroxynoraporphine | Drug Info | [529289] | |||
| (R)-(-)-N-propyl-2-methoxy-11-hydroxynoraporphine | Drug Info | [529289] | |||
| (S)-BULBOCAPNINE | Drug Info | [528616] | |||
| (S)-secoantioquine hydrochloride | Drug Info | [551356] | |||
| (S)APOMORPHINE | Drug Info | [530342] | |||
| (S,R)-antioquine hydrochloride | Drug Info | [551356] | |||
| (S,R)-isotetrandrine hydrochloride | Drug Info | [551356] | |||
| (S,R)-pseudoxandrine hydrochloride | Drug Info | [551356] | |||
| (S,S)-oxandrine hydrochloride | Drug Info | [551356] | |||
| 1,2,3,7,12,12a-hexahydro-1-aza-pleiadene-5,6-diol | Drug Info | [528616] | |||
| 1,2-Bis-[R-(-)-apomorphine-2'-oxy]ethane | Drug Info | [529349] | |||
| 1,6-bis(4-(3-chlorophenyl)piperazin-1-yl)hexane | Drug Info | [530927] | |||
| 1,6-bis(4-(3-methoxyphenyl)piperazin-1-yl)hexane | Drug Info | [530927] | |||
| 1,6-bis(4-(pyridin-2-yl)piperazin-1-yl)hexane | Drug Info | [530927] | |||
| 1,6-bis(4-m-tolylpiperazin-1-yl)hexane | Drug Info | [530927] | |||
| 1,6-bis(4-phenylpiperazin-1-yl)hexane | Drug Info | [530927] | |||
| 1-(3-Hydroxyphenyl)-4-propylpiperazine | Drug Info | [530725] | |||
| 1-(4-(1H-pyrazol-1-yl)benzyl)-4-phenylpiperazine | Drug Info | [528099] | |||
| 1-(4-(4-phenyl-1-piperazinyl)butyl)indolin-2-one | Drug Info | [528904] | |||
| 1-(benzyloxy)-2-(2-phenylethyl)benzene | Drug Info | [528493] | |||
| 1-(benzyloxy)-2-[2-(3-methoxyphenyl)ethyl]benzene | Drug Info | [528493] | |||
| 1-Aminomethyl-3-cyclohexyl-isochroman-5,6-diol | Drug Info | [529371] | |||
| 1-Aminomethyl-isochroman-5,6-diol | Drug Info | [530404] | |||
| 1-Benzyl-4-(2-ethynyl-pyrrol-1-yl)-piperidine | Drug Info | [525629] | |||
| 1-Benzyl-4-(2-iodo-pyrrol-1-yl)-piperidine | Drug Info | [525629] | |||
| 1-Benzyl-4-(2-oxazol-5-yl-pyrrol-1-yl)-piperidine | Drug Info | [525629] | |||
| 1-Benzyl-4-(3-hydroxyphenyl)piperidine | Drug Info | [530725] | |||
| 1-Benzyl-4-(3-oxazol-5-yl-pyrrol-1-yl)-piperidine | Drug Info | [525629] | |||
| 1-Benzyl-4-pyrrol-1-yl-piperidine | Drug Info | [525629] | |||
| 1-Benzyl-4-[3-(methylsulfonyl)phenyl]piperazine | Drug Info | [530725] | |||
| 1-Benzyl-4-[3-(methylsulfonyl)phenyl]piperidine | Drug Info | [530725] | |||
| 1-Dibenzo[b,f]oxepin-10-yl-4-methyl-piperazine | Drug Info | [533570] | |||
| 1-Methyl-1,2,3,4-tetrahydro-isoquinoline-6,7-diol | Drug Info | [551342] | |||
| 1-Propyl-3-(3-trifluoromethyl-phenyl)-pyrrolidine | Drug Info | [551334] | |||
| 1-Propyl-3-m-tolyl-piperidine hydrochloride | Drug Info | [526495] | |||
| 1-Propyl-3-o-tolyl-piperidine hydrochloride | Drug Info | [526495] | |||
| 1-Propyl-3-p-tolyl-piperidine hydrochloride | Drug Info | [526495] | |||
| 1-[(3-methoxybenzyl)oxy]-2-(2-phenylethyl)benzene | Drug Info | [528493] | |||
| 1-[2-(2-Benzyl-phenoxy)-ethyl]-piperidine | Drug Info | [527160] | |||
| 1-[3-(2-Benzyl-phenoxy)-propyl]-pyrrolidine | Drug Info | [527160] | |||
| 1-[3-(Methylsulfonyl)phenyl]-4-propylpiperazine | Drug Info | [530725] | |||
| 2,3-Dihydro-1H-indol-5-ol | Drug Info | [551342] | |||
| 2-(4-Dipropylamino-cyclohexylidene)-malononitrile | Drug Info | [525701] | |||
| 2-methoxyapomorphine | Drug Info | [529349] | |||
| 2-Methyl-8-phenyl-1,2,3,4-tetrahydro-isoquinoline | Drug Info | [533578] | |||
| 2-{[2-(2-phenylethyl)phenoxy]methyl}pyridine | Drug Info | [528493] | |||
| 2-{[R-(-)-Apomorphine-2'-oxy]ethoxy}-ethanol | Drug Info | [529349] | |||
| 3,8-dibromoboldine | Drug Info | [525759] | |||
| 3-(1-Propyl-pyrrolidin-3-yl)-phenol | Drug Info | [551334] | |||
| 3-(2,3-Dimethyl-phenyl)-1-propyl-piperidine | Drug Info | [534764] | |||
| 3-(2,3-Dimethyl-phenyl)-piperidine | Drug Info | [534764] | |||
| 3-(2,4-Dimethyl-phenyl)-1-propyl-piperidine | Drug Info | [534764] | |||
| 3-(2,5-Dimethyl-phenyl)-1-propyl-piperidine | Drug Info | [534764] | |||
| 3-(2,6-Dimethyl-phenyl)-1-propyl-piperidine | Drug Info | [534764] | |||
| 3-(2-Benzylamino-ethoxy)-phenol | Drug Info | [525599] | |||
| 3-(3,4-Dimethyl-phenyl)-1-propyl-piperidine | Drug Info | [534764] | |||
| 3-(3,4-Dimethyl-phenyl)-piperidine | Drug Info | [534764] | |||
| 3-(3,5-Dimethyl-phenyl)-1-propyl-piperidine | Drug Info | [534764] | |||
| 3-(3,5-Dimethyl-phenyl)-piperidine | Drug Info | [534764] | |||
| 3-(4-Benzyl-piperazin-1-yl)-phenol | Drug Info | [534802] | |||
| 3-(4-Benzyl-piperidin-1-ylmethyl)-chroman-4-one | Drug Info | [527368] | |||
| 3-(4-Methyl-piperidin-1-ylmethyl)-1H-indole | Drug Info | [534131] | |||
| 3-(4-Phenyl-piperazin-1-ylmethyl)-1H-indole | Drug Info | [534131] | |||
| 3-(4-Phenyl-piperidin-1-ylmethyl)-1H-indole | Drug Info | [534131] | |||
| 3-(N-propylpiperidin-4-yl)phenol | Drug Info | [530725] | |||
| 3-(Octahydro-indolizin-8-yl)-phenol | Drug Info | [530318] | |||
| 3-(Octahydro-quinolizin-1-yl)-phenol | Drug Info | [530318] | |||
| 3-(Octahydro-quinolizin-3-yl)-phenol | Drug Info | [530318] | |||
| 3-bromoboldine | Drug Info | [525759] | |||
| 3-Butyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-6-ol | Drug Info | [526822] | |||
| 3-Chloroboldine | Drug Info | [525759] | |||
| 3-Cyclohexyl-1-propyl-piperidine hydrochloride | Drug Info | [526495] | |||
| 3-Ethyl-2,3,4,5-tetrahydro-1H-benzo[d]azepin-6-ol | Drug Info | [526822] | |||
| 3-Iodoboldine | Drug Info | [525759] | |||
| 3-Naphthalen-1-yl-1-propyl-pyrrolidine | Drug Info | [551334] | |||
| 3-Naphthalen-1-yl-pyrrolidine | Drug Info | [551334] | |||
| 3-Phenyl-1-propyl-piperidine hydrochloride | Drug Info | [526495] | |||
| 3-Phenyl-1-propyl-pyrrolidine | Drug Info | [551334] | |||
| 3-Phenyl-pyrrolidine | Drug Info | [551334] | |||
| 3-{[2-(2-phenylethyl)phenoxy]methyl}pyridine | Drug Info | [528493] | |||
| 4-(2-Benzylamino-ethoxy)-1,3-dihydro-indol-2-one | Drug Info | [525599] | |||
| 4-(4-Benzyl-piperazin-1-yl)-1H-benzoimidazole | Drug Info | [534802] | |||
| 4-(4-Benzyl-piperazin-1-yl)-1H-indole | Drug Info | [534802] | |||
| 4-(4-Benzyl-piperazin-1-yl)-5-chloro-1H-indole | Drug Info | [534802] | |||
| 4-(4-Benzyl-piperazin-1-yl)-7-bromo-1H-indole | Drug Info | [534802] | |||
| 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [531079] | |||
| 4-Benzyl-1-chroman-2-ylmethyl-piperidine | Drug Info | [527368] | |||
| 4-Benzyl-1-chroman-3-ylmethyl-piperidine | Drug Info | [527368] | |||
| 4-Benzyl-1-indan-2-ylmethyl-piperidine | Drug Info | [527368] | |||
| 4-[3-(Methylsulfonyl)phenyl]-1-propylpiperidine | Drug Info | [530725] | |||
| 7-(2-Amino-ethyl)-4-hydroxy-3H-benzothiazol-2-one | Drug Info | [533390] | |||
| 7-(2-Dipropylamino-ethyl)-3H-benzothiazol-2-one | Drug Info | [533390] | |||
| A-690344 | Drug Info | [527867] | |||
| A-70108 | Drug Info | [530404] | |||
| A-706149 | Drug Info | [527843] | |||
| A-80426 | Drug Info | [527799] | |||
| Aniracetam | Drug Info | [551390] | |||
| ANOLOBINE | Drug Info | [528616] | |||
| ANONAINE | Drug Info | [528616] | |||
| Azaperone | Drug Info | [533796] | |||
| Benzyl-[2-(1H-indazol-4-yloxy)-ethyl]-amine | Drug Info | [525599] | |||
| Benzyl-[2-(1H-indol-4-yloxy)-ethyl]-amine | Drug Info | [525599] | |||
| Bis-{[R-(-)-apomorphine-2-oxy]ethyl} ether | Drug Info | [529349] | |||
| BOLDINE | Drug Info | [525759] | |||
| BRL-25594 | Drug Info | [526544] | |||
| BRL-26175 | Drug Info | [533954] | |||
| CLEBOPRIDE | Drug Info | [526544] | |||
| D-189 | Drug Info | [529420] | |||
| D-190 | Drug Info | [529420] | |||
| D-192 | Drug Info | [529420] | |||
| D-193 | Drug Info | [529420] | |||
| D-203 | Drug Info | [529420] | |||
| D-210 | Drug Info | [529420] | |||
| D-218 | Drug Info | [529420] | |||
| D-219 | Drug Info | [529420] | |||
| D-220 | Drug Info | [529420] | |||
| D-237 | Drug Info | [529836] | |||
| D-264 | Drug Info | [530117] | |||
| D-315 | Drug Info | [531014] | |||
| D-366 | Drug Info | [530606] | |||
| EPIDEPRIDE | Drug Info | [533883] | |||
| Ethyl-(4,5,6,7-tetrahydro-2H-indazol-5-yl)-amine | Drug Info | [533152] | |||
| ETICLOPRIDE | Drug Info | [530325] | |||
| Etoloxamine | Drug Info | [527160] | |||
| FLUANISONE | Drug Info | [533378] | |||
| FLUMEZAPINE | Drug Info | [533165] | |||
| FLUTROLINE | Drug Info | [533512] | |||
| GLAUCINE | Drug Info | [528616] | |||
| IBZM | Drug Info | [533883] | |||
| IODOPRIDE | Drug Info | [533883] | |||
| IODOSULPIRIDE | Drug Info | [533883] | |||
| ISOCLOZAPINE | Drug Info | [534532] | |||
| ISOLOXAPINE | Drug Info | [533577] | |||
| L-741626 | Drug Info | [551224] | |||
| MAZAPERTINE | Drug Info | [533800] | |||
| MCL-515 | Drug Info | [529850] | |||
| MCL-516 | Drug Info | [529850] | |||
| N-(4-Dipropylaminobutyl)-4-biphenylcarboxamide | Drug Info | [529734] | |||
| N-Benzyl-4-(2-diphenyl)-1-piperazinehexanamide | Drug Info | [529703] | |||
| N-Ethyl-2-methylnorapomorphine hydrochloride | Drug Info | [530150] | |||
| N-Ethyl-2-phenylnorapomorphine hydrochloride | Drug Info | [530150] | |||
| N-METHYLSPIPERONE | Drug Info | [527170] | |||
| N-Propyl-2-methylnorapomorphine hydrochloride | Drug Info | [530150] | |||
| N-Propyl-2-phenylnorapomorphine hydrochloride | Drug Info | [530150] | |||
| NOR-ROEFRACTINE | Drug Info | [534656] | |||
| OCTOCLOTHEPIN | Drug Info | [531171] | |||
| P2B-001 | Drug Info | [534641] | |||
| PD-128483 | Drug Info | [551251] | |||
| PD-135111 | Drug Info | [551251] | |||
| PD-135146 | Drug Info | [551251] | |||
| PD-135188 | Drug Info | [551251] | |||
| PD-135222 | Drug Info | [551251] | |||
| PD-135385 | Drug Info | [551251] | |||
| PD-135478 | Drug Info | [551251] | |||
| PD-135540 | Drug Info | [551251] | |||
| PD-137789 | Drug Info | [551251] | |||
| PD-137821 | Drug Info | [551251] | |||
| PD-168077 | Drug Info | [526495] | |||
| PD-172938 | Drug Info | [534794] | |||
| PD-172939 | Drug Info | [534794] | |||
| PG-01037 | Drug Info | [528974] | |||
| PGX-200097 | Drug Info | [531048] | |||
| Phenyltoloxamine | Drug Info | [527160] | |||
| Preclamol | Drug Info | [530318] | |||
| Propyl-(4,5,6,7-tetrahydro-2H-indazol-5-yl)-amine | Drug Info | [533152] | |||
| PUKATEINE | Drug Info | [528616] | |||
| QUINPIROLE | Drug Info | [534764] | |||
| R-N-PROPYLNORAPOMORPHINE | Drug Info | [529289] | |||
| Ro-21-7767 | Drug Info | [533759] | |||
| Rolicyclidine | Drug Info | [551388] | |||
| ROXINDOLE | Drug Info | [527191] | |||
| SB-258719 | Drug Info | [526032] | |||
| SB-271046 | Drug Info | [529191] | |||
| SCH-24518 | Drug Info | [533416] | |||
| SK&F-89626 | Drug Info | [530341] | |||
| SKF-89124A | Drug Info | [533390] | |||
| SLV-314 | Drug Info | [527822] | |||
| SNAP-94847 | Drug Info | [528972] | |||
| SPIPERONE | Drug Info | [527368] | |||
| STEPHOLIDINE | Drug Info | [530374] | |||
| TIOSPIRONE | Drug Info | [534093] | |||
| UH-232 | Drug Info | [551330] | |||
| UH-301 | Drug Info | [534363] | |||
| WAY-208466 | Drug Info | [530209] | |||
| [2-(1H-Benzoimidazol-4-yloxy)-ethyl]-benzyl-amine | Drug Info | [525599] | |||
| [R-(-)-Apomorphine-2-yl]-(2'-hydroxy-ethyl)ether | Drug Info | [529349] | |||
| Antagonist | (+)-S-14297 | Drug Info | [533585] | ||
| (S)-amisulpride | Drug Info | [536463] | |||
| 1192U90 | Drug Info | [536463] | |||
| Acetophenazine | Drug Info | [535384], [537772] | |||
| Amisulpride | Drug Info | [535384], [536014], [536228] | |||
| Anti-D | Drug Info | [536737] | |||
| APD-403 | Drug Info | [543559] | |||
| Bevantolol | Drug Info | [536450], [536477] | |||
| BL-1020 | Drug Info | [536463] | |||
| Blonanserin | Drug Info | [536463] | |||
| Carphenazine | Drug Info | [535384], [537769] | |||
| Chlorpromazine | Drug Info | [537110], [537239], [538131] | |||
| Chlorprothixene | Drug Info | [536986] | |||
| CLR-151 | Drug Info | [543559] | |||
| D1 agonist D2 antagonist | Drug Info | [536463] | |||
| Dapiprazole | Drug Info | [535858] | |||
| Domperidone | Drug Info | [536906], [537754] | |||
| Flupenthixol | Drug Info | [535384], [537355] | |||
| Fluspirilene | Drug Info | [535367] | |||
| GMC-283 | Drug Info | [536463] | |||
| Haloperidol | Drug Info | [535384], [535507] | |||
| HMR-2934 | Drug Info | [536463] | |||
| Iloperidone | Drug Info | [530677], [536463] | |||
| Lamectacin | Drug Info | [536295], [536773] | |||
| Loxapine | Drug Info | [537966] | |||
| Metoclopramide | Drug Info | [536705], [537754] | |||
| ML321 | Drug Info | [525354] | |||
| nafadotride | Drug Info | [534073] | |||
| Nomifensine | Drug Info | [536298], [537851] | |||
| Org-23366 | Drug Info | [536463] | |||
| PD-157695 | Drug Info | [536463] | |||
| PD-158771 | Drug Info | [536463] | |||
| PD-172760 | Drug Info | [536463] | |||
| Perphenazine | Drug Info | [535922], [536570] | |||
| Phenoxybenzamine | Drug Info | [537093] | |||
| Phentolamine | Drug Info | [537387] | |||
| Pimozide | Drug Info | [535384], [536264] | |||
| Prochlorperazine | Drug Info | [536926], [537996] | |||
| Raclopride | Drug Info | [537994] | |||
| Remoxipride | Drug Info | [535384], [537966] | |||
| Risperidone | Drug Info | [536910], [537559] | |||
| RP5063 | Drug Info | [549962], [551645] | |||
| S-(-)-sulpiride | Drug Info | [535012], [535493], [537994] | |||
| Sertindole | Drug Info | [536632], [537440] | |||
| SLV-307 | Drug Info | [527204] | |||
| Sulpiride | Drug Info | [535012], [535493], [537994] | |||
| Thiethylperazine | Drug Info | [537675], [537780] | |||
| Thioridazine | Drug Info | [535616], [536045] | |||
| Thiothixene | Drug Info | [537727] | |||
| Tiapride | Drug Info | [535493] | |||
| Tolazoline | Drug Info | [536163] | |||
| Umespirone | Drug Info | [528329] | |||
| Zuclopenthixol | Drug Info | [534860], [535384] | |||
| [3H]N-methylspiperone | Drug Info | [525665] | |||
| [3H]nemonapride | Drug Info | [526842] | |||
| [3H]raclopride | Drug Info | [533499] | |||
| [3H]spiperone | Drug Info | [525818] | |||
| Agonist | (-)-3PPP, Maryland | Drug Info | [536463] | ||
| (-)-N-porphynorapomorphine | Drug Info | [533725] | |||
| 7-trans-OH-PIPAT | Drug Info | [533838] | |||
| AM-831 | Drug Info | [550322] | |||
| AMR-103 | Drug Info | [527798] | |||
| Aplindore fumarate | Drug Info | [536293], [536463] | |||
| Apomorphine | Drug Info | [529937] | |||
| Aripiprazole | Drug Info | [536421] | |||
| Bromocriptine | Drug Info | [537057], [537165], [537694] | |||
| Cabergoline | Drug Info | [536995], [537018] | |||
| Carmoxirole | Drug Info | [534755] | |||
| CQA 206-291 | Drug Info | [537689] | |||
| Dihydroergotamine | Drug Info | [536777] | |||
| Dihydroergotoxine | Drug Info | [534844] | |||
| Dopamine | Drug Info | [536358], [536407] | |||
| Entacapone+levodopa+carbidopa | Drug Info | [536121] | |||
| Ephedrine | Drug Info | [536322] | |||
| Ergonovine | Drug Info | [537710] | |||
| Fencamfamine | Drug Info | [537781] | |||
| Intranasal apomorphine | Drug Info | [534197] | |||
| JNJ-37822681 | Drug Info | [532392] | |||
| Lisuride | Drug Info | [536452], [536478], [537763] | |||
| LP-12 | Drug Info | [528956] | |||
| LP-211 | Drug Info | [529703] | |||
| LP-44 | Drug Info | [528956] | |||
| Lu-02-750 | Drug Info | [548986] | |||
| Mephentermine | Drug Info | [534972] | |||
| Mesoridazine | Drug Info | [536134] | |||
| Metaraminol | Drug Info | [538109] | |||
| Methamfetamine | Drug Info | [536103] | |||
| Methyldopa | Drug Info | [536417] | |||
| MLS1547 | Drug Info | [532749] | |||
| N-0923 | Drug Info | [536923] | |||
| Naphazoline | Drug Info | [534898] | |||
| Nemonapride | Drug Info | [536463] | |||
| NOLOMIROLE HYDROCHLORIDE | Drug Info | [526875], [551871] | |||
| Olanzapine | Drug Info | [535119] | |||
| Pardoprunox | Drug Info | [536580] | |||
| PD 128907 | Drug Info | [534074] | |||
| PF-03800130 | Drug Info | [543559] | |||
| Phenylephrine | Drug Info | [534861], [537397] | |||
| piribedil | Drug Info | [526443] | |||
| Quetiapine | Drug Info | [535384], [537077] | |||
| Quinagolide | Drug Info | [535476] | |||
| Rotigitine | Drug Info | [536285] | |||
| SAVOXEPIN MESYLATE | Drug Info | [533887], [551871] | |||
| Sumanirole | Drug Info | [536923] | |||
| Talipexole | Drug Info | [538017] | |||
| Uinagolide | Drug Info | [535476] | |||
| UNC0006 | Drug Info | [531673] | |||
| UNC9975 | Drug Info | [531673] | |||
| UNC9994 | Drug Info | [531673] | |||
| WS-50030 | Drug Info | [543559] | |||
| XP-21279 | Drug Info | [532587] | |||
| Y-20024 | Drug Info | [533174], [551871] | |||
| Ziprasidone | Drug Info | [536935] | |||
| Modulator | Abaperidone | Drug Info | [553290] | ||
| ATI-9242 | Drug Info | [550651] | |||
| BAM-1110 | Drug Info | ||||
| Bifeprunox | Drug Info | ||||
| BIM23A760 | Drug Info | [528145] | |||
| BIMG80 | Drug Info | [534408] | |||
| Bis(olanzapine) pamoate monohydrate | Drug Info | [551871] | |||
| Cariprazine | Drug Info | [532651] | |||
| CGP-25454A | Drug Info | [533754] | |||
| CGS-15873A | Drug Info | [550026], [551871] | |||
| CLR-3001 | Drug Info | [549794] | |||
| CP-903397 | Drug Info | [548437] | |||
| Declopramide | Drug Info | [525463] | |||
| Denopamine | Drug Info | [536361] | |||
| Docarpamine | Drug Info | [536361] | |||
| Dopexamine | Drug Info | [536361] | |||
| DU-29894 | Drug Info | [533724] | |||
| E-2040 | Drug Info | [546599] | |||
| Etrabamine | Drug Info | [550139] | |||
| F-15063 | Drug Info | ||||
| FOSOPAMINE | Drug Info | [530448], [551871] | |||
| Ibopamine hci | Drug Info | [533417], [536361] | |||
| Levodopa | Drug Info | [540492] | |||
| Levomepromazine | Drug Info | [556264] | |||
| Lu-AE04621 | Drug Info | [549067] | |||
| Lurasidone hydrochloride | Drug Info | [530859], [531351] | |||
| LY-243062 | Drug Info | [545859] | |||
| Mazapertine succinate | Drug Info | ||||
| Naxagolide | Drug Info | [533809] | |||
| NGD-93-1 | Drug Info | [551646] | |||
| NNC-22-0031 | Drug Info | [534327] | |||
| Ocaperidone | Drug Info | [526792] | |||
| OPC-34712 | Drug Info | ||||
| Ordopidine | Drug Info | [532776] | |||
| Org-10490 | Drug Info | [556264] | |||
| PD-143188 | Drug Info | [534559] | |||
| Perazine | Drug Info | [527325], [551871] | |||
| Pergolide | Drug Info | [556264] | |||
| PF-217830 | Drug Info | ||||
| Piperacetazine | Drug Info | [556264] | |||
| PNU-96391A | Drug Info | [532971] | |||
| Pramipexole | Drug Info | [556264] | |||
| Pridopidine | Drug Info | [531022] | |||
| RBP-7000 | Drug Info | [532645] | |||
| Romergoline | Drug Info | [551899] | |||
| Ropinirole | Drug Info | [556264] | |||
| RWJ-25730 | Drug Info | ||||
| S-18327 | Drug Info | [525657] | |||
| S32504 | Drug Info | [526972] | |||
| Sarizotan | Drug Info | ||||
| SDZ-208911 | Drug Info | [528305], [551871] | |||
| SDZ-GLC-756 | Drug Info | [534322] | |||
| SDZ-MAR-327 | Drug Info | ||||
| SEL-73 | Drug Info | [543559] | |||
| Sibenadet | Drug Info | ||||
| SLV-310 | Drug Info | ||||
| SLV-313 | Drug Info | ||||
| SSR-181507 | Drug Info | ||||
| YKP-1358 | Drug Info | [528644] | |||
| Zicronapine | Drug Info | [549861] | |||
| Binder | Droperidol | Drug Info | [535656] | ||
| Molindone | Drug Info | [536346], [538098] | |||
| SKL-10406 | Drug Info | [544111] | |||
| Y-931 | Drug Info | [536463] | |||
| ZD-3638 | Drug Info | [536463] | |||
| Stimulator | Pseudoephedrine | Drug Info | [535332], [537761] | ||
| Modulator (allosteric modulator) | SB269652 | Drug Info | [532915] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Rap1 signaling pathway | ||||
| cAMP signaling pathway | |||||
| Neuroactive ligand-receptor interaction | |||||
| Gap junction | |||||
| Dopaminergic synapse | |||||
| Parkinson' | |||||
| s disease | |||||
| Cocaine addiction | |||||
| Alcoholism | |||||
| PANTHER Pathway | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | ||||
| Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway | |||||
| Dopamine receptor mediated signaling pathway | |||||
| Nicotine pharmacodynamics pathway | |||||
| Reactome | Dopamine receptors | ||||
| G alpha (i) signalling events | |||||
| WikiPathways | Hypothetical Network for Drug Addiction | ||||
| Monoamine GPCRs | |||||
| GPCRs, Class A Rhodopsin-like | |||||
| Genes and (Common) Pathways Underlying Drug Addiction | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| Nicotine Activity on Dopaminergic Neurons | |||||
| References | |||||
| Ref 467478 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4133). | ||||
| Ref 467639 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 43). | ||||
| Ref 467839 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 46). | ||||
| Ref 467939 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 47). | ||||
| Ref 468021 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4792). | ||||
| Ref 468029 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 48). | ||||
| Ref 468078 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 485). | ||||
| Ref 468121 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 50). | ||||
| Ref 468130 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 502). | ||||
| Ref 468254 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 52). | ||||
| Ref 468270 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5217). | ||||
| Ref 521931 | ClinicalTrials.gov (NCT00408915) Continuous Application of Lisuride in Parkinson's Disease by Subcutaneous Infusion. U.S. National Institutes of Health. | ||||
| Ref 522303 | ClinicalTrials.gov (NCT00665223) A Study of Treatment With ACR16 in Patients With Huntington's Disease. U.S. National Institutes of Health. | ||||
| Ref 522393 | ClinicalTrials.gov (NCT00728195) An Efficacy and Safety Study of 3 Fixed Doses of JNJ-37822681 in Participants With Schizophrenia. U.S. National Institutes of Health. | ||||
| Ref 523123 | ClinicalTrials.gov (NCT01171313) A Efficacy, Safety and Pharmacokinetic Study of XP21279 and Sinemet in Parkinson's Disease Subjects. U.S. National Institutes of Health. | ||||
| Ref 523357 | ClinicalTrials.gov (NCT01295372) Safety and Efficacy of Zicronapine in Patients With Schizophrenia. U.S. National Institutes of Health. | ||||
| Ref 523551 | ClinicalTrials.gov (NCT01397786) Safety and Tolerability Study of Oral OPC-34712 as Maintenance Treatment in Adults With Schizophrenia. U.S. National Institutes of Health. | ||||
| Ref 523723 | ClinicalTrials.gov (NCT01490086) RP5063 in Subjects With Schizophrenia or Schizoaffective Disorder. U.S. National Institutes of Health. | ||||
| Ref 524298 | ClinicalTrials.gov (NCT01857232) Dose-finding Study of APD403 to Prevent Nausea and Vomiting After Chemotherapy. U.S. National Institutes of Health. | ||||
| Ref 524487 | ClinicalTrials.gov (NCT01968460) Safety, Tolerability and Efficacy of Two Doses of Once Daily P2B001 in Subjects With Early Parkinson's Disease. U.S. National Institutes of Health. | ||||
| Ref 524579 | ClinicalTrials.gov (NCT02020408) Monoamine Contributions to Neurocircuitry in Eating Disorders. U.S. National Institutes of Health. | ||||
| Ref 524709 | ClinicalTrials.gov (NCT02109562) Randomized, Double-blind, Placebo Controlled, Multi-center and Tolerability of RBP-7000 in Schizophrenia Patients. U.S. National Institutes of Health. | ||||
| Ref 524901 | ClinicalTrials.gov (NCT02231905) Safety, Tolerability and Efficacy of Switching From Talipexole to Pramipexole in Patients With Parkinson's Disease. U.S. National Institutes of Health. | ||||
| Ref 525056 | ClinicalTrials.gov (NCT02339064) Infusion of Apomorphine: Long-term Safety Study. U.S. National Institutes of Health. | ||||
| Ref 526084 | Anxiolytic effects of aniracetam in three different mouse models of anxiety and the underlying mechanism. Eur J Pharmacol. 2001 May 18;420(1):33-43. | ||||
| Ref 526174 | Pharmacology of the atypical antipsychotic remoxipride, a dopamine D2 receptor antagonist. CNS Drug Rev. 2001 Fall;7(3):265-82. | ||||
| Ref 526775 | Pharmacokinetics and first clinical experiences with an antihypertensive dopamine (DA2) agonist. Eur Heart J. 1992 Sep;13 Suppl D:121-8. | ||||
| Ref 526776 | Pharmacologic properties of (-)-3PPP (preclamol) in man. J Neural Transm Gen Sect. 1992;88(3):165-75. | ||||
| Ref 526792 | Pharmacological profile of the new potent neuroleptic ocaperidone (R 79,598). J Pharmacol Exp Ther. 1992 Jan;260(1):146-59. | ||||
| Ref 526972 | S32504, a novel naphtoxazine agonist at dopamine D3/D2 receptors: II. Actions in rodent, primate, and cellular models of antiparkinsonian activity in comparison to ropinirole. J Pharmacol Exp Ther. 2004 Jun;309(3):921-35. Epub 2004 Feb 20. | ||||
| Ref 528061 | Rotigotine: a novel dopamine agonist for the transdermal treatment of Parkinson's disease. Drugs Today (Barc). 2006 Jan;42(1):21-8. | ||||
| Ref 528145 | BIM-23A760, a chimeric molecule directed towards somatostatin and dopamine receptors, vs universal somatostatin receptors ligands in GH-secreting pituitary adenomas partial responders to octreotide. J Endocrinol Invest. 2005;28(11 Suppl International):21-7. | ||||
| Ref 528387 | Sertindole: efficacy and safety in schizophrenia. Expert Opin Pharmacother. 2006 Sep;7(13):1825-34. | ||||
| Ref 530859 | Pharmacological profile of lurasidone, a novel antipsychotic agent with potent 5-hydroxytryptamine 7 (5-HT7) and 5-HT1A receptor activity. J Pharmacol Exp Ther. 2010 Jul;334(1):171-81. | ||||
| Ref 531697 | CQA 206-291: a novel dopamine agonist in the treatment of Parkinson's disease. Clin Neuropharmacol. 1990 Aug;13(4):303-11. | ||||
| Ref 532971 | The dopamine stabilizer (-)-OSU6162 occupies a subpopulation of striatal dopamine D2/D3 receptors: an [(11)C]raclopride PET study in healthy human subjects. Neuropsychopharmacology. 2015 Jan;40(2):472-9. | ||||
| Ref 534084 | Roxindole: psychopharmacological profile of a dopamine D2 autoreceptor agonist. J Pharmacol Exp Ther. 1996 Jan;276(1):41-8. | ||||
| Ref 534252 | 1192U90 in animal tests that predict antipsychotic efficacy, anxiolysis, and extrapyramidal side effects. Neuropsychopharmacology. 1996 Sep;15(3):231-42. | ||||
| Ref 534327 | NNC-19-1228 and NNC 22-0031, novel neuroleptics with a "mesolimbic-selective" behavioral profile. Psychopharmacology (Berl). 1997 Jan;129(2):168-78. | ||||
| Ref 534644 | Orally active benzamide antipsychotic agents with affinity for dopamine D2, serotonin 5-HT1A, and adrenergic alpha1 receptors. J Med Chem. 1998 Jun 4;41(12):1997-2009. | ||||
| Ref 534772 | Positron emission tomographic analysis of central dopamine D1 receptor binding in normal subjects treated with the atypical neuroleptic, SDZ MAR 327. Int J Mol Med. 1998 Jan;1(1):243-7. | ||||
| Ref 534844 | Pharmacologic management of Alzheimer disease, Part II: Antioxidants, antihypertensives, and ergoloid derivatives. Ann Pharmacother. 1999 Feb;33(2):188-97. | ||||
| Ref 535119 | Olanzapine: an updated review of its use in the management of schizophrenia. Drugs. 2001;61(1):111-61. | ||||
| Ref 536217 | Lisuride, a dopamine receptor agonist with 5-HT2B receptor antagonist properties: absence of cardiac valvulopathy adverse drug reaction reports supports the concept of a crucial role for 5-HT2B receptor agonism in cardiac valvular fibrosis. Clin Neuropharmacol. 2006 Mar-Apr;29(2):80-6. | ||||
| Ref 536285 | Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54. | ||||
| Ref 536322 | The effect of alpha-2 adrenergic agonists on memory and cognitive flexibility. Cogn Behav Neurol. 2006 Dec;19(4):204-7. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 536463 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31. | ||||
| Ref 536580 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. Epub 2008 Jan 2. | ||||
| Ref 536661 | Anti-obesity drugs and neural circuits of feeding. Trends Pharmacol Sci. 2008 Apr;29(4):208-17. Epub 2008 Mar 18. | ||||
| Ref 536732 | A systematic review of the efficacy of domperidone for the treatment of diabetic gastroparesis. Clin Gastroenterol Hepatol. 2008 Jul;6(7):726-33. Epub 2008 Jun 4. | ||||
| Ref 536773 | How many modes of action should an antibiotic have? Curr Opin Pharmacol. 2008 Oct;8(5):564-73. Epub 2008 Jul 30. | ||||
| Ref 536814 | Behavioral responses of dopamine beta-hydroxylase knockout mice to modafinil suggest a dual noradrenergic-dopaminergic mechanism of action. Pharmacol Biochem Behav. 2008 Dec;91(2):217-22. Epub 2008 Jul 25. | ||||
| Ref 536923 | Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42. | ||||
| Ref 537476 | Persistence and compliance to antidepressant treatment in patients with depression: a chart review. BMC Psychiatry. 2009 Jun 16;9:38. | ||||
| Ref 537532 | Update on ropinirole in the treatment of Parkinson's disease. Neuropsychiatr Dis Treat. 2009;5:33-6. Epub 2009 Apr 8. | ||||
| Ref 537632 | Electrophysiological studies in the rat brain on the basis for aripiprazole augmentation of antidepressants in major depressive disorder. Psychopharmacology (Berl). 2009 Jul 30. | ||||
| Ref 537885 | Migraine: a pharmacologic review with newer options and delivery modalities. Neurology. 1994 May;44(5 Suppl 3):S13-7. | ||||
| Ref 538160 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040058. | ||||
| Ref 538172 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040235. | ||||
| Ref 538192 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040654. | ||||
| Ref 538218 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070075. | ||||
| Ref 538220 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070184. | ||||
| Ref 538226 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070600. | ||||
| Ref 538243 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 072123. | ||||
| Ref 538291 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 075153. | ||||
| Ref 538339 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 080439. | ||||
| Ref 538343 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 080722. | ||||
| Ref 538368 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 088001. | ||||
| Ref 538389 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 006035. | ||||
| Ref 538395 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 006403. | ||||
| Ref 538457 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 012254. | ||||
| Ref 538460 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 012753. | ||||
| Ref 538474 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016149. | ||||
| Ref 538478 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016774. | ||||
| Ref 538485 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 017111. | ||||
| Ref 538488 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 017473. | ||||
| Ref 538609 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 100). | ||||
| Ref 538617 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 101). | ||||
| Ref 538723 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 121). | ||||
| Ref 538934 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 148). | ||||
| Ref 539311 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 207). | ||||
| Ref 539323 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 209). | ||||
| Ref 539343 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 212). | ||||
| Ref 539539 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 241). | ||||
| Ref 540260 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 33). | ||||
| Ref 540346 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 34). | ||||
| Ref 540438 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 35). | ||||
| Ref 540492 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3639). | ||||
| Ref 540505 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 37). | ||||
| Ref 540570 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3949). | ||||
| Ref 540779 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 534). | ||||
| Ref 540844 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5442). | ||||
| Ref 540937 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 556). | ||||
| Ref 541192 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 59). | ||||
| Ref 542148 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7140). | ||||
| Ref 542182 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7172). | ||||
| Ref 542242 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7227). | ||||
| Ref 542244 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7229). | ||||
| Ref 542299 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7279). | ||||
| Ref 542306 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7286). | ||||
| Ref 542315 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7295). | ||||
| Ref 542328 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7306). | ||||
| Ref 542333 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7310). | ||||
| Ref 542486 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7461). | ||||
| Ref 542559 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7559). | ||||
| Ref 542649 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7670). | ||||
| Ref 542650 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7671). | ||||
| Ref 542651 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7672). | ||||
| Ref 543051 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 83). | ||||
| Ref 543173 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 85). | ||||
| Ref 543216 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 86). | ||||
| Ref 543255 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 87). | ||||
| Ref 543290 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 90). | ||||
| Ref 543312 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 94). | ||||
| Ref 543313 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 940). | ||||
| Ref 543322 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 953). | ||||
| Ref 543327 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 96). | ||||
| Ref 543328 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 960). | ||||
| Ref 543330 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 963). | ||||
| Ref 543331 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 965). | ||||
| Ref 543333 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 968). | ||||
| Ref 543343 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 98). | ||||
| Ref 543347 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 983). | ||||
| Ref 544058 | Optimizing levodopa therapy for Parkinson's disease with levodopa/carbidopa/entacapone: implications from a clinical and patient perspective. Neuropsychiatr Dis Treat. 2008 February; 4(1): 39-47. | ||||
| Ref 544679 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000562) | ||||
| Ref 544699 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000647) | ||||
| Ref 544712 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000698) | ||||
| Ref 544868 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001374) | ||||
| Ref 544873 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001388) | ||||
| Ref 544883 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001412) | ||||
| Ref 544888 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001422) | ||||
| Ref 544892 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001430) | ||||
| Ref 545125 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002218) | ||||
| Ref 545255 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002585) | ||||
| Ref 545272 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002657) | ||||
| Ref 545274 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002662) | ||||
| Ref 545340 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002902) | ||||
| Ref 545464 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003364) | ||||
| Ref 545467 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003368) | ||||
| Ref 545667 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004095) | ||||
| Ref 545858 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005079) | ||||
| Ref 545888 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005232) | ||||
| Ref 546028 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005971) | ||||
| Ref 546043 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006017) | ||||
| Ref 546146 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006596) | ||||
| Ref 546239 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007055) | ||||
| Ref 546521 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008736) | ||||
| Ref 546598 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009126) | ||||
| Ref 546690 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009651) | ||||
| Ref 547082 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012906) | ||||
| Ref 547323 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015146) | ||||
| Ref 547459 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016551) | ||||
| Ref 548315 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024498) | ||||
| Ref 548392 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025217) | ||||
| Ref 548436 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025558) | ||||
| Ref 548438 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025560) | ||||
| Ref 548466 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025731) | ||||
| Ref 548528 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026348) | ||||
| Ref 548733 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028165) | ||||
| Ref 548985 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031195) | ||||
| Ref 549066 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031909) | ||||
| Ref 549113 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032468) | ||||
| Ref 549136 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032727) | ||||
| Ref 551583 | Pharmacokinetics, Pharmacodynamics and Tolerance of SLV 307 After Single Oral Administration in Healthy Male Volunteers. Clinical Pharmacology & Therapeutics. 02/1999; 65(2). | ||||
| Ref 525354 | Discovery, optimization, and characterization of a novel series of dopamine D2 versus D3 receptor selective antagonists. Probe Reports from the NIH Molecular Libraries Program [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2010-. | ||||
| Ref 525463 | Pharmacokinetics and central nervous system toxicity of declopramide (3-chloroprocainamide) in rats and mice. Anticancer Drugs. 1999 Jan;10(1):79-88. | ||||
| Ref 525599 | Bioorg Med Chem Lett. 1999 Sep 6;9(17):2593-8.New generation dopaminergic agents. 7. Heterocyclic bioisosteres that exploit the 3-OH-phenoxyethylamine D2 template. | ||||
| Ref 525629 | Bioorg Med Chem Lett. 1999 Nov 1;9(21):3143-6.Piperidinylpyrroles: design, synthesis and binding properties of novel and selective dopamine D4 receptor ligands. | ||||
| Ref 525657 | S18327 (1-[2-[4-(6-fluoro-1, 2-benzisoxazol-3-yl)piperid-1-yl]ethyl]3-phenyl imidazolin-2-one), a novel, potential antipsychotic displaying marked antagonist properties at alpha(1)- and alpha(2)-adrenergic receptors: I. Receptorial, neurochemical, and electrophysiological profile. J Pharmacol Exp Ther. 2000 Jan;292(1):38-53. | ||||
| Ref 525665 | Nonconserved residues in the second transmembrane-spanning domain of the D(4) dopamine receptor are molecular determinants of D(4)-selective pharmacology. Mol Pharmacol. 2000 Jan;57(1):144-52. | ||||
| Ref 525701 | J Med Chem. 2000 Feb 24;43(4):756-62.Conjugated enynes as nonaromatic catechol bioisosteres: synthesis, binding experiments, and computational studies of novel dopamine receptor agonists recognizing preferentially the D(3) subtype. | ||||
| Ref 525759 | J Nat Prod. 2000 Apr;63(4):480-4.Halogenated boldine derivatives with enhanced monoamine receptor selectivity. | ||||
| Ref 525818 | Regulation of human D(1), d(2(long)), d(2(short)), D(3) and D(4) dopamine receptors by amiloride and amiloride analogues. Br J Pharmacol. 2000 Jul;130(5):1045-59. | ||||
| Ref 526032 | J Med Chem. 2001 Apr 26;44(9):1337-40.Atropisomeric derivatives of 2',6'-disubstituted (R)-11-phenylaporphine: selective serotonin 5-HT(7) receptor antagonists. | ||||
| Ref 526443 | Differential actions of antiparkinson agents at multiple classes of monoaminergic receptor. I. A multivariate analysis of the binding profiles of 14 drugs at 21 native and cloned human receptor subtypes. J Pharmacol Exp Ther. 2002 Nov;303(2):791-804. | ||||
| Ref 526495 | J Med Chem. 2003 Jan 2;46(1):161-8.New N-n-propyl-substituted 3-aryl- and 3-cyclohexylpiperidines as partial agonists at the D4 dopamine receptor. | ||||
| Ref 526544 | J Med Chem. 2003 Feb 27;46(5):702-15.Synthesis and structure-affinity relationships of novel N-(1-ethyl-4-methylhexahydro-1,4-diazepin-6-yl)pyridine-3-carboxamides with potent serotonin 5-HT3 and dopamine D2 receptor antagonistic activity. | ||||
| Ref 526792 | Pharmacological profile of the new potent neuroleptic ocaperidone (R 79,598). J Pharmacol Exp Ther. 1992 Jan;260(1):146-59. | ||||
| Ref 526822 | J Med Chem. 1992 Oct 30;35(22):3984-90.6-Hydroxy-3-n-propyl-2,3,4,5-tetrahydro-1H-3-benzazepine and analogs: new centrally acting 5-HT1A receptor agonists. | ||||
| Ref 526842 | Potent activation of dopamine D3/D2 heterodimers by the antiparkinsonian agents, S32504, pramipexole and ropinirole. J Neurochem. 2003 Nov;87(3):631-41. | ||||
| Ref 526875 | Effect of nolomirole on monocrotaline-induced heart failure. Pharmacol Res. 2004 Jan;49(1):1-5. | ||||
| Ref 526972 | S32504, a novel naphtoxazine agonist at dopamine D3/D2 receptors: II. Actions in rodent, primate, and cellular models of antiparkinsonian activity in comparison to ropinirole. J Pharmacol Exp Ther. 2004 Jun;309(3):921-35. Epub 2004 Feb 20. | ||||
| Ref 527160 | J Med Chem. 2004 Aug 12;47(17):4155-8.Dopamine/serotonin receptor ligands. 9. Oxygen-containing midsized heterocyclic ring systems and nonrigidized analogues. A step toward dopamine D5 receptor selectivity. | ||||
| Ref 527170 | J Med Chem. 1992 Feb 7;35(3):423-30.Effect of N-alkylation on the affinities of analogues of spiperone for dopamine D2 and serotonin 5-HT2 receptors. | ||||
| Ref 527204 | Development and validation of a capillary electrophoresis method for the enantiomeric purity determination of SLV307, a basic potential antipsychotic compound. Electrophoresis. 2004 Aug;25(16):2854-9. | ||||
| Ref 527325 | Synthesis and in vitro binding of N-phenyl piperazine analogs as potential dopamine D3 receptor ligands. Bioorg Med Chem. 2005 Jan 3;13(1):77-87. | ||||
| Ref 527368 | J Med Chem. 2005 Jan 13;48(1):266-73.Synthesis and structure-activity relationships of 1-aralkyl-4-benzylpiperidine and 1-aralkyl-4-benzylpiperazine derivatives as potent sigma ligands. | ||||
| Ref 527798 | ACP-103, a 5-HT2A/2C inverse agonist, potentiates haloperidol-induced dopamine release in rat medial prefrontal cortex and nucleus accumbens. Psychopharmacology (Berl). 2005 Dec;183(2):144-53. Epub 2005 Nov 9. | ||||
| Ref 527799 | J Med Chem. 2005 Oct 20;48(21):6523-43.Designed multiple ligands. An emerging drug discovery paradigm. | ||||
| Ref 527822 | J Med Chem. 2005 Nov 3;48(22):6855-69.Synthesis, structure-activity relationships, and biological properties of 1-heteroaryl-4-[omega-(1H-indol-3-yl)alkyl]piperazines, novel potential antipsychotics combining potent dopamine D2 receptor antagonism with potent serotonin reuptake inhibition. | ||||
| Ref 527843 | Bioorg Med Chem Lett. 2006 Feb;16(3):658-62. Epub 2005 Nov 2.Synthesis and SAR of highly potent and selective dopamine D(3)-receptor antagonists: Quinolin(di)one and benzazepin(di)one derivatives. herve.geneste@abbott.com. | ||||
| Ref 527867 | Bioorg Med Chem Lett. 2006 Feb;16(3):490-4. Epub 2005 Nov 11.Synthesis and SAR of highly potent and selective dopamine D(3)-receptor antagonists: 1H-pyrimidin-2-one derivatives. | ||||
| Ref 528099 | Bioorg Med Chem Lett. 2006 Jun 1;16(11):2955-9. Epub 2006 Mar 24.Synthesis and biological investigations of dopaminergic partial agonists preferentially recognizing the D4 receptor subtype. | ||||
| Ref 528145 | BIM-23A760, a chimeric molecule directed towards somatostatin and dopamine receptors, vs universal somatostatin receptors ligands in GH-secreting pituitary adenomas partial responders to octreotide. J Endocrinol Invest. 2005;28(11 Suppl International):21-7. | ||||
| Ref 528305 | Effects of the partial dopamine receptor agonists SDZ 208-911, SDZ 208-912 and terguride on central monoamine receptors. A behavioral, biochemical and electrophysiological study. Naunyn SchmiedebergsArch Pharmacol. 1991 Sep;344(3):263-74. | ||||
| Ref 528329 | The effects of umespirone as a potential anxiolytic and antipsychotic agent. Pharmacol Biochem Behav. 1991 Sep;40(1):89-96. | ||||
| Ref 528493 | J Med Chem. 2006 Nov 2;49(22):6607-13.Arylmethyloxyphenyl derivatives: small molecules displaying P-glycoprotein inhibition. | ||||
| Ref 528616 | J Med Chem. 2007 Jan 25;50(2):171-81.Advances in development of dopaminergic aporphinoids. | ||||
| Ref 528644 | Modeling of brain D2 receptor occupancy-plasma concentration relationships with a novel antipsychotic, YKP1358, using serial PET scans in healthy volunteers. Clin Pharmacol Ther. 2007 Feb;81(2):252-8. | ||||
| Ref 528876 | Bioorg Med Chem Lett. 2007 Aug 1;17(15):4128-30. Epub 2007 May 23.R-(-)-N-alkyl-11-hydroxy-10-hydroxymethyl- and 10-methyl-aporphines as 5-HT1A receptor ligands. | ||||
| Ref 528904 | Bioorg Med Chem. 2007 Sep 1;15(17):5811-8. Epub 2007 Jun 7.Synthesis of novel lactam derivatives and their evaluation as ligands for the dopamine receptors, leading to a D(4)-selective ligand. | ||||
| Ref 528956 | Structure-activity relationship study on N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides, a class of 5-HT7 receptor agents. 2. J Med Chem. 2007 Aug 23;50(17):4214-21. Epub 2007 Jul 25. | ||||
| Ref 528972 | J Med Chem. 2007 Aug 9;50(16):3883-90.Synthesis and SAR investigations for novel melanin-concentrating hormone 1 receptor (MCH1) antagonists part 2: A hybrid strategy combining key fragments of HTS hits. | ||||
| Ref 528974 | J Med Chem. 2007 Aug 23;50(17):4135-46. Epub 2007 Aug 2.Heterocyclic analogues of N-(4-(4-(2,3-dichlorophenyl)piperazin-1-yl)butyl)arylcarboxamides with functionalized linking chains as novel dopamine D3 receptor ligands: potential substance abuse therapeutic agents. | ||||
| Ref 529191 | Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43. Epub 2007 Nov 17.Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. | ||||
| Ref 529289 | J Med Chem. 2008 Feb 28;51(4):983-7. Epub 2008 Feb 6.Synthesis and dopamine receptor affinities of N-alkyl-11-hydroxy-2-methoxynoraporphines: N-alkyl substituents determine D1 versus D2 receptor selectivity. | ||||
| Ref 529328 | Bioorg Med Chem. 2008 Apr 1;16(7):3773-9. Epub 2008 Feb 5.Synthesis and neuropharmacological evaluation of 2-aryl- and alkylapomorphines. | ||||
| Ref 529349 | Bioorg Med Chem. 2008 Apr 15;16(8):4563-8. Epub 2008 Feb 15.Synthesis and neuropharmacological characterization of 2-O-substituted apomorphines. | ||||
| Ref 529371 | J Med Chem. 1991 Oct;34(10):2946-53.Synthesis and pharmacological evaluation of 1-(aminomethyl)-3,4-dihydro-5-hydroxy-1H-2-benzopyrans as dopamine D1 selective ligands. | ||||
| Ref 529420 | J Med Chem. 2008 May 22;51(10):3005-19. Epub 2008 Apr 12.Bioisosteric heterocyclic versions of 7-{[2-(4-phenyl-piperazin-1-yl)ethyl]propylamino}-5,6,7,8-tetrahydronaphthalen-2-ol: identification of highly potent and selective agonists for dopamine D3 receptor with potent in vivo activity. | ||||
| Ref 529703 | J Med Chem. 2008 Sep 25;51(18):5813-22.Structural modifications of N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides: influence on lipophilicity and 5-HT7 receptor activity. Part III. | ||||
| Ref 529734 | J Med Chem. 2008 Nov 13;51(21):6829-38. Epub 2008 Oct 4.Novel D3 selective dopaminergics incorporating enyne units as nonaromatic catechol bioisosteres: synthesis, bioactivity, and mutagenesis studies. | ||||
| Ref 529836 | J Med Chem. 2008 Dec 25;51(24):7806-19.Structurally constrained hybrid derivatives containing octahydrobenzo[g or f]quinoline moieties for dopamine D2 and D3 receptors: binding characterization at D2/D3 receptors and elucidation of a pharmacophore model. | ||||
| Ref 529850 | Bioorg Med Chem Lett. 2009 Jan 1;19(1):51-3. Epub 2008 Nov 13.Synthesis and neuropharmacological evaluation of esters of R(-)-N-alkyl-11-hydroxy-2-methoxynoraporphines. | ||||
| Ref 529937 | Dopamine D(2/3) receptor occupancy of apomorphine in the nonhuman primate brain--a comparative PET study with [11C]raclopride and [11C]MNPA. Synapse. 2009 May;63(5):378-89. | ||||
| Ref 530114 | J Med Chem. 2009 Jun 11;52(11):3548-62.Specific targeting of peripheral serotonin 5-HT(3) receptors. Synthesis, biological investigation, and structure-activity relationships. | ||||
| Ref 530117 | Bioorg Med Chem. 2009 Jun 1;17(11):3923-33. Epub 2009 Apr 19.Investigation of various N-heterocyclic substituted piperazine versions of 5/7-{[2-(4-aryl-piperazin-1-yl)-ethyl]-propyl-amino}-5,6,7,8-tetrahydro-naphthalen-2-ol: effect on affinity and selectivity for dopamine D3 receptor. | ||||
| Ref 530150 | Bioorg Med Chem. 2009 Jul 1;17(13):4756-62. Epub 2009 May 3.N-Substituted-2-alkyl- and 2-arylnorapomorphines: novel, highly active D2 agonists. | ||||
| Ref 530209 | Bioorg Med Chem. 2009 Jul 15;17(14):5153-63. Epub 2009 May 29.Novel 1-aminoethyl-3-arylsulfonyl-1H-pyrrolo[2,3-b]pyridines are potent 5-HT(6) agonists. | ||||
| Ref 530310 | J Med Chem. 1990 Jan;33(1):311-7.4-(1,2,5,6-Tetrahydro-1-alkyl-3-pyridinyl)-2-thiazolamines: a novel class of compounds with central dopamine agonist properties. | ||||
| Ref 530318 | J Med Chem. 1990 Mar;33(3):1015-22.Pre- and postsynaptic dopaminergic activities of indolizidine and quinolizidine derivatives of 3-(3-hydroxyphenyl)-N-(n-propyl)piperidine (3-PPP). Further developments of a dopamine receptor model. | ||||
| Ref 530325 | J Med Chem. 1990 Apr;33(4):1155-63.Potential antipsychotic agents 5. Synthesis and antidopaminergic properties of substituted 5,6-dimethoxysalicylamides and related compounds. | ||||
| Ref 530341 | J Med Chem. 1990 Jun;33(6):1756-64.trans-10,11-dihydroxy-5,6,6a,7,8,12b-hexahydrobenzo[a]phenanthridine: a highly potent selective dopamine D1 full agonist. | ||||
| Ref 530342 | J Med Chem. 1990 Jun;33(6):1800-5.Synthesis and dopamine receptor affinities of enantiomers of 2-substituted apomorphines and their N-n-propyl analogues. | ||||
| Ref 530374 | Bioorg Med Chem. 2009 Oct 1;17(19):6898-907. Epub 2009 Aug 20.Dibenzazecine scaffold rebuilding--is the flexibility always essential for high dopamine receptor affinities?. | ||||
| Ref 530404 | J Med Chem. 1990 Nov;33(11):2948-50.(1R,3S)-1-(aminomethyl)-3,4-dihydro-5,6-dihydroxy-3-phenyl-1H-2-benzopyran: a potent and selective D1 agonist. | ||||
| Ref 530448 | Development of dopaminergic drugs for the chronic treatment of congestive heart failure. J Auton Pharmacol. 1990;10 Suppl 1:s85-93. | ||||
| Ref 530558 | Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. | ||||
| Ref 530606 | J Med Chem. 2010 Feb 11;53(3):1023-37.Development of (S)-N6-(2-(4-(isoquinolin-1-yl)piperazin-1-yl)ethyl)-N6-propyl-4,5,6,7-tetrahydrobenzo[d]-thiazole-2,6-diamine and its analogue as a D3 receptor preferring agonist: potent in vivo activity in Parkinson's disease animal models. | ||||
| Ref 530725 | J Med Chem. 2010 Mar 25;53(6):2510-20.Synthesis and evaluation of a set of 4-phenylpiperidines and 4-phenylpiperazines as D2 receptor ligands and the discovery of the dopaminergic stabilizer 4-[3-(methylsulfonyl)phenyl]-1-propylpiperidine (huntexil, pridopidine, ACR16). | ||||
| Ref 530859 | Pharmacological profile of lurasidone, a novel antipsychotic agent with potent 5-hydroxytryptamine 7 (5-HT7) and 5-HT1A receptor activity. J Pharmacol Exp Ther. 2010 Jul;334(1):171-81. | ||||
| Ref 530927 | J Med Chem. 2010 Jun 24;53(12):4803-7.Discovery of bishomo(hetero)arylpiperazines as novel multifunctional ligands targeting dopamine D(3) and serotonin 5-HT(1A) and 5-HT(2A) receptors. | ||||
| Ref 531014 | Bioorg Med Chem. 2010 Aug 1;18(15):5661-74. Epub 2010 Jun 12.Further delineation of hydrophobic binding sites in dopamine D(2)/D(3) receptors for N-4 substituents on the piperazine ring of the hybrid template 5/7-{[2-(4-aryl-piperazin-1-yl)-ethyl]-propyl-amino}-5,6,7,8-tetrahydro-naphthalen-2-ol. | ||||
| Ref 531022 | Efficacy and safety of the dopaminergic stabilizer Pridopidine (ACR16) in patients with Huntington's disease. Clin Neuropharmacol. 2010 Sep-Oct;33(5):260-4. | ||||
| Ref 531048 | Schizophrenia, "just the facts" 5. Treatment and prevention. Past, present, and future. Schizophr Res. 2010 Sep;122(1-3):1-23. | ||||
| Ref 531079 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
| Ref 531171 | J Med Chem. 2010 Oct 14;53(19):7021-34.Exploring the neuroleptic substituent in octoclothepin: potential ligands for positron emission tomography with subnanomolar affinity for |A(1)-adrenoceptors. | ||||
| Ref 531673 | Discovery of beta-arrestin-biased dopamine D2 ligands for probing signal transduction pathways essential for antipsychotic efficacy. Proc Natl Acad Sci U S A. 2011 Nov 8;108(45):18488-93. | ||||
| Ref 532392 | Population pharmacokinetics of JNJ-37822681, a selective fast-dissociating dopamine D??receptor antagonist, in healthy subjects and subjects with schizophrenia and dose selection based on simulated D??receptor occupancy. Clin Pharmacokinet. 2013 Nov;52(11):1005-15. | ||||
| Ref 532587 | Double-blind study of the actively transported levodopa prodrug XP21279 in Parkinson's disease. Mov Disord. 2014 Jan;29(1):75-82. | ||||
| Ref 532645 | Population pharmacokinetics and prediction of dopamine D2 receptor occupancy after multiple doses of RBP-7000, a new sustained-release formulation of risperidone, in schizophrenia patients on stable oral risperidone treatment. Clin Pharmacokinet. 2014 Jun;53(6):533-43. | ||||
| Ref 532749 | Discovery and characterization of a G protein-biased agonist that inhibits beta-arrestin recruitment to the D2 dopamine receptor. Mol Pharmacol. 2014 Jul;86(1):96-105. | ||||
| Ref 532776 | The dopaminergic stabilizers pridopidine and ordopidine enhance cortico-striatal Arc gene expression. J Neural Transm. 2014 Nov;121(11):1337-47. | ||||
| Ref 532915 | A new mechanism of allostery in a G protein-coupled receptor dimer. Nat Chem Biol. 2014 Sep;10(9):745-52. | ||||
| Ref 532971 | The dopamine stabilizer (-)-OSU6162 occupies a subpopulation of striatal dopamine D2/D3 receptors: an [(11)C]raclopride PET study in healthy human subjects. Neuropsychopharmacology. 2015 Jan;40(2):472-9. | ||||
| Ref 533152 | J Med Chem. 1989 Oct;32(10):2388-96.Substituted 5-amino-4,5,6,7-tetrahydroindazoles as partial ergoline structures with dopaminergic activity. | ||||
| Ref 533165 | J Med Chem. 1989 Dec;32(12):2573-82.Synthesis and pharmacological evaluation of a series of 4-piperazinylpyrazolo[3,4-b]- and -[4,3-b][1,5]benzodiazepines as potential anxiolytics. | ||||
| Ref 533174 | Neuroleptic properties of Y-20024, a new benzofurancarboxamide derivative. Nihon Yakurigaku Zasshi. 1989 Nov;94(5):269-80. | ||||
| Ref 533378 | J Med Chem. 1987 Nov;30(11):2099-104.2-Phenylpyrroles as conformationally restricted benzamide analogues. A new class of potential antipsychotics. 1. | ||||
| Ref 533390 | J Med Chem. 1987 Jul;30(7):1166-76.Synthesis and evaluation of non-catechol D-1 and D-2 dopamine receptor agonists: benzimidazol-2-one, benzoxazol-2-one, and the highly potent benzothiazol-2-one 7-ethylamines. | ||||
| Ref 533416 | J Med Chem. 1988 Oct;31(10):1941-6.Synthesis and pharmacological characterization of 1-phenyl-, 4-phenyl-, and 1-benzyl-1,2,3,4-tetrahydroisoquinolines as dopamine receptor ligands. | ||||
| Ref 533417 | Ibopamine. A preliminary review of its pharmacodynamic and pharmacokinetic properties and therapeutic efficacy. Drugs. 1988 Jul;36(1):11-31. | ||||
| Ref 533499 | Specific in vitro and in vivo binding of 3H-raclopride. A potent substituted benzamide drug with high affinity for dopamine D-2 receptors in the rat brain. Biochem Pharmacol. 1985 Jul 1;34(13):2251-9. | ||||
| Ref 533512 | J Med Chem. 1980 Jun;23(6):635-43.Neuroleptic activity in 5-aryltetrahydro-gamma-carbolines. | ||||
| Ref 533570 | J Med Chem. 1982 Jul;25(7):855-8.Affinity of 10-(4-methylpiperazino)dibenz[b,f]oxepins for clozapine and spiroperidol binding sites in rat brain. | ||||
| Ref 533577 | J Med Chem. 1981 Sep;24(9):1021-6.Synthesis of clozapine analogues and their affinity for clozapine and spiroperidol binding sites in rat brain. | ||||
| Ref 533578 | J Med Chem. 1981 Sep;24(9):1107-10.Synthesis and evaluation of 1,2,3,4-tetrahydro[1]benzothieno[2,3-h]isoquinolines as dopamine antagonists. | ||||
| Ref 533585 | Functional correlates of dopamine D3 receptor activation in the rat in vivo and their modulation by the selective antagonist, (+)-S 14297: 1. Activation of postsynaptic D3 receptors mediates hypothermia, whereas blockade of D2 receptors elicits prolactin secretion and catalepsy. J Pharmacol Exp Ther. 1995 Nov;275(2):885-98. | ||||
| Ref 533724 | A comparison of the neuro-endocrinological and temperature effects of DU 29894, flesinoxan, sulpiride and haloperidol in normal volunteers. Br J Clin Pharmacol. 1995 Jan;39(1):7-14. | ||||
| Ref 533725 | A functional test identifies dopamine agonists selective for D3 versus D2 receptors. Neuroreport. 1995 Jan 26;6(2):329-32. | ||||
| Ref 533754 | CGP 25454A, a novel and selective presynaptic dopamine autoreceptor antagonist. Naunyn Schmiedebergs Arch Pharmacol. 1994 Sep;350(3):230-8. | ||||
| Ref 533759 | J Med Chem. 1995 Jan 20;38(2):318-27.Evaluation of cis- and trans-9- and 11-hydroxy-5,6,6a,7,8,12b-hexahydrobenzo[a]phenanthridines as structurally rigid, selective D1 dopamine receptor ligands. | ||||
| Ref 533796 | J Med Chem. 1993 Nov 26;36(24):3929-36.Evaluation of the effects of the enantiomers of reduced haloperidol, azaperol, and related 4-amino-1-arylbutanols on dopamine and sigma receptors. | ||||
| Ref 533800 | J Med Chem. 1994 Apr 15;37(8):1060-2.A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. | ||||
| Ref 533809 | Comparison between the pharmacology of dopamine receptors mediating the inhibition of cell firing in rat brain slices through the substantia nigra pars compacta and ventral tegmental area. Br J Pharmacol. 1994 Jul;112(3):873-80. | ||||
| Ref 533838 | Iodinated 2-aminotetralins and 3-amino-1-benzopyrans: ligands for dopamine D2 and D3 receptors. J Med Chem. 1994 Nov 25;37(24):4245-50. | ||||
| Ref 533883 | J Med Chem. 1993 Jan 22;36(2):221-8.Fluorinated and iodinated dopamine agents: D2 imaging agents for PET and SPECT. | ||||
| Ref 533887 | Savoxepine: striatal dopamine-D2 receptor occupancy in human volunteers measured using positron emission tomography (PET). Eur J Clin Pharmacol. 1993;44(2):135-40. | ||||
| Ref 533938 | J Med Chem. 1993 Oct 15;36(21):3188-96.Substituted 3-phenylpiperidines: new centrally acting dopamine autoreceptor antagonists. | ||||
| Ref 533954 | J Med Chem. 1993 Nov 12;36(23):3707-20.18F-labeled benzamides for studying the dopamine D2 receptor with positron emission tomography. | ||||
| Ref 534073 | Nafadotride, a potent preferential dopamine D3 receptor antagonist, activates locomotion in rodents. J Pharmacol Exp Ther. 1995 Dec;275(3):1239-46. | ||||
| Ref 534074 | Neurochemical and functional characterization of the preferentially selective dopamine D3 agonist PD 128907. J Pharmacol Exp Ther. 1995 Dec;275(3):1355-66. | ||||
| Ref 534093 | J Med Chem. 1996 Jan 5;39(1):143-8.3-Benzisothiazolylpiperazine derivatives as potential atypical antipsychotic agents. | ||||
| Ref 534131 | J Med Chem. 1996 May 10;39(10):1941-2.3-((4-(4-Chlorophenyl)piperazin-1-yl)-methyl)-1H-pyrrolo-2,3-b-pyridine: an antagonist with high affinity and selectivity for the human dopamine D4 receptor. | ||||
| Ref 534197 | Dopamine agonists used in the treatment of Parkinson's disease and their selectivity for the D1, D2, and D3 dopamine receptors in human striatum. Prog Neuropsychopharmacol Biol Psychiatry. 1995 Nov;19(7):1147-54. | ||||
| Ref 534244 | J Med Chem. 1996 Oct 11;39(21):4285-98.3-amino-3,4-dihydro-2H-1-benzopyran derivatives as 5-HT1A receptor ligands and potential anxiolytic agents. 2. Synthesis and quantitative structure-activity relationship studies of spiro[pyrrolidine- and piperidine-2,3'(2'H)-benzopyrans]. | ||||
| Ref 534322 | SDZ GLC 756, a novel octahydrobenzo[g]quinoline derivative exerts opposing effects on dopamine D1 and D2 receptors. J Neural Transm. 1996;103(1-2):17-30. | ||||
| Ref 534327 | NNC-19-1228 and NNC 22-0031, novel neuroleptics with a "mesolimbic-selective" behavioral profile. Psychopharmacology (Berl). 1997 Jan;129(2):168-78. | ||||
| Ref 534363 | J Med Chem. 1997 Apr 11;40(8):1252-7.N-[2-[(substituted chroman-8-yl)oxy]ethyl]-4-(4-methoxyphenyl)butylamines: synthesis and wide range of antagonism at the human 5-HT1A receptor. | ||||
| Ref 534408 | BIMG 80, a novel potential antipsychotic drug: evidence for multireceptor actions and preferential release of dopamine in prefrontal cortex. J Neurochem. 1997 Jul;69(1):182-90. | ||||
| Ref 534532 | J Med Chem. 1997 Dec 5;40(25):4146-53.Synthesis and pharmacological evaluation of triflate-substituted analogues of clozapine: identification of a novel atypical neuroleptic. | ||||
| Ref 534559 | Anxiolytic effects of dopamine receptor ligands: I. Involvement of dopamine autoreceptors. Life Sci. 1998;62(7):649-63. | ||||
| Ref 534641 | Pharmacology of pramipexole, a dopamine D3-preferring agonist useful in treating Parkinson's disease. Clin Neuropharmacol. 1998 May-Jun;21(3):141-51. | ||||
| Ref 534656 | J Nat Prod. 1998 Jun 26;61(6):709-12.Synthesis and dopamine receptor selectivity of the benzyltetrahydroisoquinoline, (R)-(+)-nor-roefractine. | ||||
| Ref 534755 | Neurohumoral response to carmoxirole, a selective dopamine (D2) receptor agonist, in patients with chronic moderate heart failure. Cardiovasc Drugs Ther. 1998 Sep;12(4):387-94. | ||||
| Ref 534764 | J Med Chem. 1998 Dec 3;41(25):4933-8.N-n-Propyl-substituted 3-(dimethylphenyl)piperidines display novel discriminative properties between dopamine receptor subtypes: synthesis and receptor binding studies. | ||||
| Ref 534794 | Bioorg Med Chem Lett. 1998 Jun 16;8(12):1499-502.Isoindolinone enantiomers having affinity for the dopamine D4 receptor. | ||||
| Ref 534802 | Bioorg Med Chem Lett. 1998 Oct 6;8(19):2675-80.New generation dopaminergic agents. 5. Heterocyclic bioisosteres that exploit the 3-OH-N1-phenylpiperazine dopaminergic template. | ||||
| Ref 534844 | Pharmacologic management of Alzheimer disease, Part II: Antioxidants, antihypertensives, and ergoloid derivatives. Ann Pharmacother. 1999 Feb;33(2):188-97. | ||||
| Ref 534860 | An ethopharmacological assessment of the effects of zuclopenthixol on agonistic interactions in male mice. Methods Find Exp Clin Pharmacol. 1999 Jan-Feb;21(1):11-5. | ||||
| Ref 534861 | Intracellular Ca2+ and adrenergic responsiveness of cardiac myocytes in streptozotocin-induced diabetes. Clin Exp Pharmacol Physiol. 1999 Apr;26(4):347-53. | ||||
| Ref 534972 | Present state of alpha- and beta-adrenergic drugs I. The adrenergic receptor. Am Heart J. 1976 Nov;92(5):661-4. | ||||
| Ref 535012 | D(2) dopamine receptors enable delta(9)-tetrahydrocannabinol induced memory impairment and reduction of hippocampal extracellular acetylcholine concentration. Br J Pharmacol. 2000 Jul;130(6):1201-10. | ||||
| Ref 535119 | Olanzapine: an updated review of its use in the management of schizophrenia. Drugs. 2001;61(1):111-61. | ||||
| Ref 535367 | Inhibition of glutamate release by fluspirilene in cerebrocortical nerve terminals (synaptosomes). Synapse. 2002 Apr;44(1):36-41. | ||||
| Ref 535476 | Effect of dopamine receptor agonists on sensory nerve activity: possible therapeutic targets for the treatment of asthma and COPD. Br J Pharmacol. 2002 Jun;136(4):620-8. | ||||
| Ref 535493 | The treatment of Tourette's syndrome: current opinions. Expert Opin Pharmacother. 2002 Jul;3(7):899-914. | ||||
| Ref 535507 | Dopaminergic synapses in the matrix of the ventrolateral striatum after chronic haloperidol treatment. Synapse. 2002 Aug;45(2):78-85. | ||||
| Ref 535616 | Models of drug treatment in the attention deficit disorder with hyperactivity. Rev Neurol. 2002 Feb;34 Suppl 1:S98-S106. | ||||
| Ref 535656 | Alpha-adrenergic blockade: a possible mechanism of tocolytic action of certain benzodiazepines in a postpartum rat model in vivo. Life Sci. 2003 Jan 24;72(10):1093-102. | ||||
| Ref 535858 | Effect of ibopamine on aqueous humor production in normotensive humans. Invest Ophthalmol Vis Sci. 2003 Nov;44(11):4853-8. | ||||
| Ref 535922 | A cross-validation study on the relationship between central D2 receptor occupancy and serum perphenazine concentration. Psychopharmacology (Berl). 2004 Sep;175(2):148-53. Epub 2004 Mar 6. | ||||
| Ref 536014 | Amisulpride: a review of its use in the management of schizophrenia. CNS Drugs. 2004;18(13):933-56. | ||||
| Ref 536045 | Antipsychotics lack alpha 1A/B adrenoceptor subtype selectivity in the rat. Eur Neuropsychopharmacol. 2005 Mar;15(2):231-4. | ||||
| Ref 536121 | Emerging drugs for restless legs syndrome. Expert Opin Emerg Drugs. 2005 Aug;10(3):537-52. | ||||
| Ref 536134 | Intrinsic efficacy of antipsychotics at human D2, D3, and D4 dopamine receptors: identification of the clozapine metabolite N-desmethylclozapine as a D2/D3 partial agonist. J Pharmacol Exp Ther. 2005Dec;315(3):1278-87. Epub 2005 Aug 31. | ||||
| Ref 536163 | Comparative effects of tolazoline and nitroprusside on human isolated radial artery. Ann Thorac Surg. 2006 Jan;81(1):125-31. | ||||
| Ref 536228 | Mechanism of action of atypical antipsychotic drugs and the neurobiology of schizophrenia. CNS Drugs. 2006;20(5):389-409. | ||||
| Ref 536264 | The benzamides tiapride, sulpiride, and amisulpride in treatment for Tourette's syndrome. Nervenarzt. 2007 Mar;78(3):264, 266-8, 270-1. | ||||
| Ref 536285 | Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54. | ||||
| Ref 536293 | Aplindore (DAB-452), a high affinity selective dopamine D2 receptor partial agonist. Eur J Pharmacol. 2006 Dec 15;552(1-3):36-45. Epub 2006 Sep 14. | ||||
| Ref 536298 | Pharmacologically induced, subsecond dopamine transients in the caudate-putamen of the anesthetized rat. Synapse. 2007 Jan;61(1):37-9. | ||||
| Ref 536322 | The effect of alpha-2 adrenergic agonists on memory and cognitive flexibility. Cogn Behav Neurol. 2006 Dec;19(4):204-7. | ||||
| Ref 536346 | Molindone for schizophrenia and severe mental illness. Cochrane Database Syst Rev. 2007 Jan 24;(1):CD002083. | ||||
| Ref 536358 | The Detection of Dopamine Gene Receptors (DRD1-DRD5) Expression on Human Peripheral Blood Lymphocytes by Real Time PCR. Iran J Allergy Asthma Immunol. 2004 Dec;3(4):169-74. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 536407 | Polymorphisms in dopamine receptor DRD1 and DRD2 genes and psychopathological and extrapyramidal symptoms in patients on long-term antipsychotic treatment. Am J Med Genet B Neuropsychiatr Genet. 2007Sep 5;144B(6):809-15. | ||||
| Ref 536417 | Centrally acting antihypertensive agents: an update. J Clin Hypertens (Greenwich). 2007 May;9(5):399-405. | ||||
| Ref 536421 | Aripiprazole acts as a selective dopamine D2 receptor partial agonist. Expert Opin Investig Drugs. 2007 Jun;16(6):771-5. | ||||
| Ref 536450 | Different changes of plasma membrane beta-adrenoceptors in rat heart after chronic administration of propranolol, atenolol and bevantolol. Life Sci. 2007 Jul 12;81(5):399-404. Epub 2007 Jun 16. | ||||
| Ref 536452 | Medical management of levodopa-associated motor complications in patients with Parkinson's disease. CNS Drugs. 2007;21(8):677-92. | ||||
| Ref 536463 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31. | ||||
| Ref 536477 | Determination of bevantolol in human plasma by high performance liquid chromatography using solid phase extraction technique. Arch Pharm Res. 2007 Jul;30(7):890-7. | ||||
| Ref 536478 | Fibrotic heart-valve reactions to dopamine-agonist treatment in Parkinson's disease. Lancet Neurol. 2007 Sep;6(9):826-9. | ||||
| Ref 536570 | CYP2D6 and DRD2 genes differentially impact pharmacodynamic sensitivity and time course of prolactin response to perphenazine. Pharmacogenet Genomics. 2007 Nov;17(11):989-93. | ||||
| Ref 536580 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. Epub 2008 Jan 2. | ||||
| Ref 536632 | Dopamine D2(High) receptors moderately elevated by sertindole. Synapse. 2008 May;62(5):389-93. | ||||
| Ref 536705 | Mechanisms for metoclopramide-mediated sensitization and haloperidol-induced catalepsy in rats. Eur J Pharmacol. 2008 Jun 10;587(1-3):181-6. Epub 2008 Apr 6. | ||||
| Ref 536737 | Emerging drugs for idiopathic thrombocytopenic purpura in adults. Expert Opin Emerg Drugs. 2008 Jun;13(2):237-54. | ||||
| Ref 536773 | How many modes of action should an antibiotic have? Curr Opin Pharmacol. 2008 Oct;8(5):564-73. Epub 2008 Jul 30. | ||||
| Ref 536777 | Current and prospective pharmacological targets in relation to antimigraine action. Naunyn Schmiedebergs Arch Pharmacol. 2008 Oct;378(4):371-94. Epub 2008 Jul 15. | ||||
| Ref 536906 | Screening of domperidone in wastewater by high performance liquid chromatography and solid phase extraction methods. Talanta. 2006 Jan 15;68(3):928-31. Epub 2005 Jul 22. | ||||
| Ref 536910 | Upcoming agents for the treatment of schizophrenia: mechanism of action, efficacy and tolerability. Drugs. 2008;68(16):2269-92. | ||||
| Ref 536923 | Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42. | ||||
| Ref 536926 | In vitro and in vivo characteristics of prochlorperazine oral disintegrating film. Int J Pharm. 2009 Feb 23;368(1-2):98-102. Epub 2008 Oct 15. | ||||
| Ref 536935 | Striatal and extrastriatal D2/D3-receptor-binding properties of ziprasidone: a positron emission tomography study with [18F]Fallypride and [11C]raclopride (D2/D3-receptor occupancy of ziprasidone). JClin Psychopharmacol. 2008 Dec;28(6):608-17. | ||||
| Ref 536986 | Potential utility of histamine H3 receptor antagonist pharmacophore in antipsychotics. Bioorg Med Chem Lett. 2009 Jan 15;19(2):538-42. Epub 2008 Sep 7. | ||||
| Ref 536995 | Protection against paraquat and A53T alpha-synuclein toxicity by cabergoline is partially mediated by dopamine receptors. J Neurol Sci. 2009 Mar 15;278(1-2):44-53. Epub 2008 Dec 21. | ||||
| Ref 537018 | Role of D1 and D2 receptors in the regulation of voluntary movements. Bull Exp Biol Med. 2008 Jul;146(1):14-7. | ||||
| Ref 537057 | Striatal dopamine predicts outcome-specific reversal learning and its sensitivity to dopaminergic drug administration. J Neurosci. 2009 Feb 4;29(5):1538-43. | ||||
| Ref 537077 | Receptor reserve-dependent properties of antipsychotics at human dopamine D2 receptors. Eur J Pharmacol. 2009 Apr 1;607(1-3):35-40. Epub 2009 Feb 13. | ||||
| Ref 537093 | Catecholamine-secreting neuroblastoma in a 4-month-old infant: perioperative management. J Clin Anesth. 2009 Feb;21(1):54-6. | ||||
| Ref 537110 | Basolateral amygdala D1- and D2-dopaminergic system promotes the formation of long-term potentiation in the dentate gyrus of anesthetized rats. Prog Neuropsychopharmacol Biol Psychiatry. 2009 Apr 30;33(3):552-6. Epub 2009 Feb 23. | ||||
| Ref 537165 | Silymarin BIO-C, an extract from Silybum marianum fruits, induces hyperprolactinemia in intact female rats. Phytomedicine. 2009 Sep;16(9):839-44. Epub 2009 Mar 20. | ||||
| Ref 537239 | Modulatory role of dopamine D2 receptors and fundamental role of L-type Ca2+ channels in the induction of long-term potentiation in the basolateral amygdala-dentate gyrus pathway of anesthetized rats. Eur J Pharmacol. 2009 Mar 15;606(1-3):90-3. Epub 2009 Jan 22. | ||||
| Ref 537355 | A role for medial prefrontal dopaminergic innervation in instrumental conditioning. J Neurosci. 2009 May 20;29(20):6599-606. | ||||
| Ref 537387 | Nesfatin-1 exerts cardiovascular actions in brain: possible interaction with the central melanocortin system. Am J Physiol Regul Integr Comp Physiol. 2009 Aug;297(2):R330-6. Epub 2009 May 27. | ||||
| Ref 537397 | MMP-2 Induced Vein Relaxation via Inhibition of [Ca(2+)](e)-Dependent Mechanisms of Venous Smooth Muscle Contraction. Role of RGD Peptides. J Surg Res. 2008 Oct 24. | ||||
| Ref 537440 | Effect of sertindole on extracellular dopamine, acetylcholine, and glutamate in the medial prefrontal cortex of conscious rats: a comparison with risperidone and exploration of mechanisms involved. Psychopharmacology (Berl). 2009 Jun 9. | ||||
| Ref 537559 | Randomized clinical comparison of perospirone and risperidone in patients with schizophrenia: Kansai Psychiatric Multicenter Study. Psychiatry Clin Neurosci. 2009 Jun;63(3):322-8. | ||||
| Ref 537689 | The antiparkinsonian activity of CQA 206-291, a new D2 dopamine receptor agonist. Clin Neuropharmacol. 1989 Feb;12(1):55-9. | ||||
| Ref 537694 | The behavioral toxicity of bromocriptine in patients with psychiatric illness. J Clin Psychopharmacol. 1989 Dec;9(6):417-22. | ||||
| Ref 537710 | Agonist profile of ergometrine (ergonovine) on a population of postsynaptic alpha-adrenoceptors. J Pharm Pharmacol. 1988 Feb;40(2):137-9. | ||||
| Ref 537727 | Dopaminergic stimulation of cAMP accumulation in cultured rat mesangial cells. Am J Physiol. 1987 Aug;253(2 Pt 2):H358-64. | ||||
| Ref 537754 | The significance of disordered gastric emptying. Z Gastroenterol. 1986 Sep;24 Suppl 2:45-54. | ||||
| Ref 537761 | Drugs for cough and cold symptoms in hypertensive patients. Am Fam Physician. 1985 Mar;31(3):183-7. | ||||
| Ref 537763 | Tolerance to some behavioural effects of lisuride, a dopamine receptor agonist, and reverse tolerance to others, after repeated administration. Neuropharmacology. 1985 Mar;24(3):199-206. | ||||
| Ref 537769 | Comparison of dosage ranges of carphenazine and trifluoperazine in elderly chronic schizophrenics. Dis Nerv Syst. 1968 Oct;29(10):695-7. | ||||
| Ref 537772 | Specific therapeutic actions of acetophenazine, perphenazine, and benzquinamide in newly admitted schizophrenic patients. Clin Pharmacol Ther. 1967 Mar-Apr;8(2):249-55. | ||||
| Ref 537780 | Antiemetic specificity of dopamine antagonists. Psychopharmacology (Berl). 1982;78(3):210-3. | ||||
| Ref 537781 | Dopamine uptake inhibiting versus dopamine releasing properties of fencamfamine: an in vitro study. Biochem Pharmacol. 1983 Aug 1;32(15):2329-31. | ||||
| Ref 537851 | Dopamine D2 receptors: a potential pharmacological target for nomifensine and tranylcypromine but not other antidepressant treatments. Pharmacol Biochem Behav. 1995 Aug;51(4):565-9. | ||||
| Ref 537966 | Remoxipride in Parkinson's disease: differential response in patients with dyskinesias fluctuations versus psychosis. Clin Neuropharmacol. 1995 Feb;18(1):39-45. | ||||
| Ref 537994 | The effects of antipsychotic drugs on Fos protein expression in the prefrontal cortex: cellular localization and pharmacological characterization. Neuroscience. 1996 Jan;70(2):377-89. | ||||
| Ref 537996 | Tardive dyskinesia as a result of long-term prochlorperazine use. South Med J. 1996 Oct;89(10):989-91. | ||||
| Ref 538017 | Effects of talipexole on emesis-related changes in abdominal afferent vagal activity and ileal serotonin metabolism in rats. Res Commun Mol Pathol Pharmacol. 1997 Jan;95(1):67-82. | ||||
| Ref 538098 | Antipsychotic drugs which elicit little or no parkinsonism bind more loosely than dopamine to brain D2 receptors, yet occupy high levels of these receptors. Mol Psychiatry. 1998 Mar;3(2):123-34. | ||||
| Ref 538109 | Alpha1-adrenoceptor stimulation enhances experimental gastric carcinogenesis induced by N-methyl-N'-nitro-N-nitrosoguanidine in Wistar rats. Int J Cancer. 1998 Jul 29;77(3):467-9. | ||||
| Ref 538131 | Behavioral and neurochemical methods in research on new psychotropics. Ann Pharm Fr. 1998;56(2):54-9. | ||||
| Ref 540492 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3639). | ||||
| Ref 543559 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 215). | ||||
| Ref 544111 | Bi-directional modulation of BNST neurons by 5-HT: Molecular expression and functional properties of excitatory 5-HT receptor subtypes. Neuroscience. 2009 December 29; 164(4): 1776-1793. | ||||
| Ref 545859 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005079) | ||||
| Ref 546599 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009126) | ||||
| Ref 548437 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025558) | ||||
| Ref 548986 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031195) | ||||
| Ref 549067 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031909) | ||||
| Ref 549962 | Drug Development in Schizophrenia: Summary and Table. Pharmaceutical Medicine October 2014, Volume 28, Issue 5, pp 265-271 | ||||
| Ref 550026 | Biochemical and pharmacological characterization of the putative dopamine autoreceptor agonist benzopyranopyridine, CGS 15873A. Article first published online: 5 OCT 2004. | ||||
| Ref 550651 | Pharmacological characteristics of ATI-9242, a Novel Atypical Antipsychotic. FASEB J, April, 2010, 24(Meeting Abstract Supplement),773.12. | ||||
| Ref 551224 | Synthesis and characterization of selective dopamine D2 receptor antagonists. 2. Azaindole, benzofuran, and benzothiophene analogs of L-741,626. Bioorg Med Chem. 2010 Jul 15;18(14):5291-300. doi: 10.1016/j.bmc.2010.05.052. Epub 2010 May 24. | ||||
| Ref 551251 | Synthesis and pharmacological evaluation of the enantiomers of the dopamine autoreceptor agonist PD 135385, Bioorg. Med. Chem. Lett. 3(4):639-644 (1993). | ||||
| Ref 551330 | (Dipropylamino)-tetrahydronaphthofurans: centrally acting serotonin agonists and dopamine agonists-antagonists, Bioorg. Med. Chem. Lett. 7(21):2759-2764 (1997). | ||||
| Ref 551334 | Regioselective synthesis of 3-aryl substituted pyrrolidines via palladium catalyzed arylation: pharmacological evaluation for central dopaminergic and serotonergic activity, Bioorg. Med. Chem. Lett. 7(3):241-246 (1997). | ||||
| Ref 551342 | D4 dopamine receptor-selective compounds from the Chinese plant Phoebe chekiangensis, Bioorg. Med. Chem. Lett. 7(9):1207-1212 (1997). | ||||
| Ref 551356 | Displacement activity of bisbenzylisoquinoline alkaloids at striatal 3H-SCH 23390 and 3H-raclopride binding sites. J Nat Prod. 1992 Sep;55(9):1281-6. | ||||
| Ref 551390 | Anxiolytic effects of aniracetam in three different mouse models of anxiety and the underlying mechanism. Eur J Pharmacol. 2001 May 18;420(1):33-43. | ||||
| Ref 551645 | EFFICACY AND SAFETY OF NOVEL DOPAMINE SEROTONIN STABILIZER RP 5063 IN ACUTE SCHIZOPHRENIA AND SCHIZOAFFECTIVE DISORDER. Schizophrenia Research Volume 153, Supplement 1, April 2014, Pages S22. | ||||
| Ref 551646 | Dopamine D4 receptors in human postmortem brain tissue of normal and schizophrenic subjects. An [3]NGD-94-1 study. Schizophrenia Research Volume 29, Issues 1-2, January 1998, Pages 93. | ||||
| Ref 551871 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
| Ref 551899 | CA patent application no. 648479, Implants for the treatment of dopamine associated states. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.