Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T59626
|
||||
| Former ID |
TTDC00129
|
||||
| Target Name |
Leukotriene B4 receptor 1
|
||||
| Gene Name |
LTB4R
|
||||
| Synonyms |
Chemoattractant receptor-like 1; LTB4-R; LTB4-R 1; Leukotriene B(4) receptor BLT1; P2Y purinoceptor 7; P2Y7; LTB4R
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Allergy [ICD9: 995.3; ICD10: T78.4] | ||||
| Asthma [ICD10: J45] | |||||
| Cystic fibrosis [ICD9: 277; ICD10: E84] | |||||
| Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26] | |||||
| Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
| Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51] | |||||
| Osteoporosis [ICD9: 733.0, V07.4; ICD10: M80-M81, Z79.890] | |||||
| Pancreatic cancer [ICD9: 140-199, 140-229, 157, 210-229; ICD10: C25] | |||||
| Psoriasis [ICD9: 696; ICD10: L40] | |||||
| Renal cancer [ICD9: 140-229, 189; ICD10: C64] | |||||
| Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
| Function |
Receptor for extracellular ATP > UTP and ADP.The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. May be the cardiac P2Y receptor involved in the regulation of cardiac muscle contraction through modulation of L-type calcium currents. Is a receptor for leukotriene B4, a potent chemoattractant involved in inflammation and immune response.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T59626
|
||||
| UniProt ID | |||||
| Sequence |
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Amelubant | Drug Info | Discontinued in Phase 2 | Cystic fibrosis | [524934], [543153] |
| CI-949 | Drug Info | Discontinued in Phase 2 | Asthma | [544546] | |
| CP-195543 | Drug Info | Discontinued in Phase 2 | Rheumatoid arthritis | [521954], [541345] | |
| LTB 019 | Drug Info | Discontinued in Phase 2 | Asthma | [547374] | |
| LTB4 | Drug Info | Discontinued in Phase 2 | Human immunodeficiency virus infection | [521756], [539612] | |
| LY-223982 | Drug Info | Discontinued in Phase 2 | Asthma | [540360], [545163] | |
| LY293111 | Drug Info | Discontinued in Phase 2 | Pancreatic cancer | [539959], [545441] | |
| SB-201993 | Drug Info | Discontinued in Phase 2 | Psoriasis | [545457] | |
| SC-41930 | Drug Info | Discontinued in Phase 2 | Inflammatory bowel disease | [541346], [544920] | |
| Biomed 101 | Drug Info | Discontinued in Phase 1 | Renal cancer | [521466] | |
| CP-105696 | Drug Info | Discontinued in Phase 1 | Inflammatory bowel disease | [540322], [545980] | |
| DW-1350 | Drug Info | Terminated | Osteoporosis | [548554] | |
| LY-210073 | Drug Info | Terminated | Asthma | [534014] | |
| LY-255283 | Drug Info | Terminated | Asthma | [540308], [544999] | |
| LY-292728 | Drug Info | Terminated | Discovery agent | [546277] | |
| RG-14893 | Drug Info | Terminated | Asthma | [544957] | |
| Ro-25-4094 | Drug Info | Terminated | Inflammatory disease | [545933] | |
| RP-66153 | Drug Info | Terminated | Asthma | [545628] | |
| RP-66364 | Drug Info | Terminated | Inflammatory disease | [545586] | |
| RP-69698 | Drug Info | Terminated | Inflammatory disease | [545550] | |
| SB-201146 | Drug Info | Terminated | Discovery agent | [545581] | |
| SB-209247 | Drug Info | Terminated | Psoriasis | [546167] | |
| SC-51146 | Drug Info | Terminated | Discovery agent | [545165] | |
| SC-53228 | Drug Info | Terminated | Asthma | [546132] | |
| U 75302 | Drug Info | Terminated | Allergy | [540285], [544531] | |
| Inhibitor | (3S,4R)-3-Benzyl-7-isopropyl-chroman-4-ol | Drug Info | [551327] | ||
| (LTB4-(Csa)4)2-Glu-H Conjugate | Drug Info | [527773] | |||
| CP-105696 | Drug Info | [551327] | |||
| DTPA Conjugate | Drug Info | [527773] | |||
| HYNIC Analogue | Drug Info | [527773] | |||
| LEUCETTAMIDINE | Drug Info | [551357] | |||
| LEUCETTAMINE A | Drug Info | [551357] | |||
| LEUKOTRIENE_B4 | Drug Info | [551272] | |||
| LY-255283 | Drug Info | [533797] | |||
| LY-282210 | Drug Info | [533960] | |||
| LY-292728 | Drug Info | [533960] | |||
| SB-201146 | Drug Info | [534210] | |||
| SB-201993 | Drug Info | [534210] | |||
| SC-41390 | Drug Info | [551272] | |||
| SC-50073 | Drug Info | [551272] | |||
| SC-50135 | Drug Info | [551272] | |||
| SC-50676 | Drug Info | [551272] | |||
| SC-51146 | Drug Info | [551272] | |||
| SC-52073 | Drug Info | [551272] | |||
| SC-52569 | Drug Info | [551272] | |||
| SC-53228 | Drug Info | [551272] | |||
| SC-53229 | Drug Info | [551272] | |||
| Antagonist | Amelubant | Drug Info | [536071], [536162] | ||
| CP-195543 | Drug Info | [530288] | |||
| LTB 019 | Drug Info | [536562] | |||
| LY293111 | Drug Info | [536139], [536318], [537053] | |||
| SB-209247 | Drug Info | [527274] | |||
| U 75302 | Drug Info | [535025] | |||
| Binder | Biomed 101 | Drug Info | [550277] | ||
| Modulator | CI-949 | Drug Info | [528462] | ||
| DW-1350 | Drug Info | [548594] | |||
| LY-210073 | Drug Info | [534014] | |||
| LY-223982 | Drug Info | [526763] | |||
| RG-14893 | Drug Info | [534207] | |||
| Ro-25-4094 | Drug Info | [545934] | |||
| RP-66153 | Drug Info | [526746] | |||
| RP-66364 | Drug Info | [550934] | |||
| RP-69698 | Drug Info | [526761] | |||
| SC-41930 | Drug Info | [526724] | |||
| Agonist | LTB4 | Drug Info | [533148] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
| NetPath Pathway | IL4 Signaling Pathway | ||||
| Reactome | Leukotriene receptors | ||||
| G alpha (q) signalling events | |||||
| WikiPathways | Nucleotide GPCRs | ||||
| GPCRs, Class A Rhodopsin-like | |||||
| Gastrin-CREB signalling pathway via PKC and MAPK | |||||
| Spinal Cord Injury | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| References | |||||
| Ref 521466 | ClinicalTrials.gov (NCT00004890) Biomed 101 and Interleukin-2 in Treating Patients With Kidney Cancer. U.S. National Institutes of Health. | ||||
| Ref 521756 | ClinicalTrials.gov (NCT00251537) A Pilot Study of LTB4 in HIV-1 Infected Adults. U.S. National Institutes of Health. | ||||
| Ref 521954 | ClinicalTrials.gov (NCT00424294) A Study Of CP-195543 And Celecoxib Dual Therapy In Subjects With Rheumatoid Arthritis. U.S. National Institutes of Health. | ||||
| Ref 524934 | ClinicalTrials.gov (NCT02251210) Efficacy and Safety of BIIL 284 BS in Adult Patients With Active Rheumatoid Arthritis. U.S. National Institutes of Health. | ||||
| Ref 534014 | Design, synthesis, and pharmacological evaluation of potent xanthone dicarboxylic acid leukotriene B4 receptor antagonists. J Med Chem. 1993 Jun 11;36(12):1726-34. | ||||
| Ref 539612 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2487). | ||||
| Ref 539959 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2948). | ||||
| Ref 540285 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3325). | ||||
| Ref 540308 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3351). | ||||
| Ref 540322 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3368). | ||||
| Ref 540360 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3415). | ||||
| Ref 541345 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6155). | ||||
| Ref 541346 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6156). | ||||
| Ref 543153 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8463). | ||||
| Ref 544531 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000072) | ||||
| Ref 544546 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000104) | ||||
| Ref 544920 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001549) | ||||
| Ref 544957 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001715) | ||||
| Ref 544999 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001833) | ||||
| Ref 545163 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002326) | ||||
| Ref 545165 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002332) | ||||
| Ref 545441 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003262) | ||||
| Ref 545457 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003335) | ||||
| Ref 545550 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003683) | ||||
| Ref 545581 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003774) | ||||
| Ref 545586 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003795) | ||||
| Ref 545628 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003980) | ||||
| Ref 545933 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005401) | ||||
| Ref 545980 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005644) | ||||
| Ref 546132 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006478) | ||||
| Ref 546167 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006734) | ||||
| Ref 546277 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007211) | ||||
| Ref 526724 | Multiple actions of the leukotriene B4 receptor antagonist SC-41930. J Pharmacol Exp Ther. 1992 Jan;260(1):187-91. | ||||
| Ref 526746 | Omega-[(omega-arylalkyl)thienyl]alkanoic acids: from specific LTA4 hydrolase inhibitors to LTB4 receptor antagonists. J Med Chem. 1992 Aug 21;35(17):3170-9. | ||||
| Ref 526761 | omega-[(4,6-Diphenyl-2-pyridyl)oxy]alkanoic acid derivatives: a new family of potent and orally active LTB4 antagonists. J Med Chem. 1992 Nov 13;35(23):4315-24. | ||||
| Ref 526763 | Specific inhibition of leukotriene B4-induced neutrophil activation by LY223982. J Pharmacol Exp Ther. 1992 Dec;263(3):1009-14. | ||||
| Ref 527274 | Formation and protein binding of the acyl glucuronide of a leukotriene B4 antagonist (SB-209247): relation to species differences in hepatotoxicity. Drug Metab Dispos. 2005 Feb;33(2):271-81. Epub 2004 Nov 2. | ||||
| Ref 527773 | J Med Chem. 2005 Oct 6;48(20):6442-53.Synthesis of leukotriene B4 antagonists labeled with In-111 or Tc-99m to image infectious and inflammatory foci. | ||||
| Ref 528462 | Inhibition of histamine, leukotriene C4/D4, and thromboxane B2 release from human leukocytes and human chopped lung mast cells by the allergic mediator release inhibitor, CI-949. J Allergy Clin Immunol. 1990 Dec;86(6 Pt 1):902-8. | ||||
| Ref 530288 | The synthesis of CP-195543, an LTB4 antagonist for the treatment of inflammatory diseases. Curr Opin Drug Discov Devel. 1999 Nov;2(6):550-6. | ||||
| Ref 533148 | LTB4 promotes insulin resistance in obese mice by acting on macrophages, hepatocytes and myocytes. Nat Med. 2015 Mar;21(3):239-47. | ||||
| Ref 533797 | J Med Chem. 1993 Nov 26;36(24):3978-81.o-phenylphenols: potent and orally active leukotriene B4 receptor antagonists. | ||||
| Ref 533960 | J Med Chem. 1993 Nov 26;36(24):3982-4.Biphenylyl-substituted xanthones: highly potent leukotriene B4 receptor antagonists. | ||||
| Ref 534014 | Design, synthesis, and pharmacological evaluation of potent xanthone dicarboxylic acid leukotriene B4 receptor antagonists. J Med Chem. 1993 Jun 11;36(12):1726-34. | ||||
| Ref 534207 | Structure-activity relationships study of two series of leukotriene B4 antagonists: novel indolyl and naphthyl compounds substituted with a 2-[methyl(2-phenethyl)amino]-2-oxoethyl side chain. J Med Chem. 1996 Sep 13;39(19):3756-68. | ||||
| Ref 534210 | J Med Chem. 1996 Sep 13;39(19):3837-41.(E)-3-[6-[[(2,6-dichlorophenyl)thio]methyl]-3-(2-phenylethoxy)-2- pyridinyl]-2-propenoic acid: a high-affinity leukotriene B4 receptor antagonist with oral antiinflammatory activity. | ||||
| Ref 535025 | A second leukotriene B(4) receptor, BLT2. A new therapeutic target in inflammation and immunological disorders. J Exp Med. 2000 Aug 7;192(3):421-32. | ||||
| Ref 536139 | Leukotriene B4 receptor inhibitor LY293111 induces cell cycle arrest and apoptosis in human anaplastic large-cell lymphoma cells via JNK phosphorylation. Leukemia. 2005 Nov;19(11):1977-84. | ||||
| Ref 536162 | Leukotriene receptor antagonists in children with cystic fibrosis lung disease : anti-inflammatory and clinical effects. Paediatr Drugs. 2005;7(6):353-63. | ||||
| Ref 536318 | A phase I study of oral LY293111 given daily in combination with irinotecan in patients with solid tumours. Invest New Drugs. 2007 Jun;25(3):217-25. Epub 2006 Dec 5. | ||||
| Ref 536562 | Effect of the oral leukotriene B4 receptor antagonist LTB019 on inflammatory sputum markers in patients with chronic obstructive pulmonary disease. Pulm Pharmacol Ther. 2008;21(2):409-17. | ||||
| Ref 537053 | The Role of PPARgamma Receptors and Leukotriene B(4) Receptors in Mediating the Effects of LY293111 in Pancreatic Cancer. PPAR Res. 2008;2008:827096. Epub 2009 Jan 27. | ||||
| Ref 545934 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005401) | ||||
| Ref 548594 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026850) | ||||
| Ref 550277 | Biomed 101, a leukotriene B4 inhibitor, may decrease IL-2 toxicity. 2003 ASCO Annual Meeting. 2003. | ||||
| Ref 550934 | WO patent application no. 1997,0297,75, Compositions comprising a cyclooxygenase-2 inhibitor and a leukotriene b4 receptor antagonist. | ||||
| Ref 551272 | Synthesis and pharmacological activity of SC-53228, a leukotriene B4 receptor antagonist with high intrinsic potency and selectivity, Bioorg. Med. Chem. Lett. 4(6):811-816 (1994). | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.