Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T98933
|
||||
| Former ID |
TTDR01227
|
||||
| Target Name |
Thyroid hormone receptor beta-1
|
||||
| Gene Name |
THRB
|
||||
| Synonyms |
Nuclear receptor subfamily 1 group A member 2; Thyroid hormone receptor beta; c-erbA-2; c-erbA-beta; THRB
|
||||
| Target Type |
Successful
|
||||
| Disease | Hypothyroidism [ICD9: 244; ICD10: E03] | ||||
| High cholesterol levels in blood [ICD10: E78.0] | |||||
| Hyperlipidaemia [ICD9: 272.0-272.4; ICD10: E78] | |||||
| Hyperthyroidism [ICD9: 242; ICD10: E05] | |||||
| Lipid metabolism disorder [ICD10: E75-E78] | |||||
| Wound healing [ICD10: T14.0-T14.1] | |||||
| Function |
Nuclear hormone receptor that can act as a repressor or activator of transcription. High affinity receptor for thyroid hormones, including triiodothyronine and thyroxine.
|
||||
| BioChemical Class |
Nuclear hormone receptor
|
||||
| Target Validation |
T98933
|
||||
| UniProt ID | |||||
| Sequence |
MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQ
TTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR CITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVL DDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWK QKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL SSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Dextrothyroxine Sodium | Drug Info | Approved | High cholesterol levels in blood | [551871] |
| BCT303 | Drug Info | Phase 2 | Hypothyroidism | [549461] | |
| MB-07811 | Drug Info | Phase 2 | Hyperlipidaemia | [522631] | |
| Axitirome | Drug Info | Phase 1 | Hyperlipidaemia | [544305] | |
| MGL-3196 | Drug Info | Phase 1 | Hyperlipidaemia | [532494] | |
| ZYT-1 | Drug Info | Phase 1 | Lipid metabolism disorder | [523811] | |
| tiratricol | Drug Info | Clinical trial | Wound healing | [539702] | |
| Inhibitor | (3,5-Dibromo-4-butoxy-phenyl)-acetic acid | Drug Info | [527532] | ||
| (3,5-Dibromo-4-hexyloxy-phenyl)-acetic acid | Drug Info | [527532] | |||
| (3,5-Dibromo-4-pentyloxy-phenyl)-acetic acid | Drug Info | [527532] | |||
| (4-hexylphenyl)(oxiran-2-yl)methanone | Drug Info | [529081] | |||
| (E)-1-(4-heptylphenyl)but-2-en-1-one | Drug Info | [529081] | |||
| (Z)-4-(4-hexylphenylamino)-4-oxobut-2-enoic acid | Drug Info | [529081] | |||
| 1-(4-(Hexyloxy)phenyl)-3-morpholinopropan-1-one | Drug Info | [530166] | |||
| 1-(4-heptylphenyl)prop-2-en-1-one | Drug Info | [529081] | |||
| 1-(4-hexylphenyl)-3-(propylamino)propan-1-one | Drug Info | [529081] | |||
| 1-(4-hexylphenyl)-3-morpholinopropan-1-one | Drug Info | [529081] | |||
| 1-(4-HEXYLPHENYL)PROP-2-EN-1-ONE | Drug Info | [551374] | |||
| 1-(4-octylphenyl)prop-2-en-1-one | Drug Info | [529081] | |||
| 2-hexylphenyl acrylate | Drug Info | [529081] | |||
| 3-(3,5-Dibromo-4-hexyloxy-phenyl)-propionic acid | Drug Info | [527532] | |||
| 3-(4-(benzyloxy)-3,5-dibromophenyl)propanoic acid | Drug Info | [528640] | |||
| 3-(dibutylamino)-1-(4-hexylphenyl)propan-1-one | Drug Info | [529081] | |||
| 3-(dimethylamino)-1-(4-heptylphenyl)propan-1-one | Drug Info | [530166] | |||
| 3-(dimethylamino)-1-(4-hexylphenyl)propan-1-one | Drug Info | [529081] | |||
| 3-bromo-1-(4-hexylphenyl)propan-1-one | Drug Info | [529081] | |||
| 4-(3-(Dimethylamino)propanoyl)-N-hexylbenzamide | Drug Info | [530166] | |||
| 4-(4-hexylphenyl)-4-oxobut-2-enoic acid | Drug Info | [529081] | |||
| 4-hexylphenyl propiolate | Drug Info | [529081] | |||
| Cacodylate Ion | Drug Info | [551393] | |||
| Detrothyronine | Drug Info | [527923] | |||
| GC-24 | Drug Info | [551393] | |||
| Modulator | Axitirome | Drug Info | [544305] | ||
| BCT303 | Drug Info | [1572591] | |||
| Dextrothyroxine Sodium | Drug Info | [556264] | |||
| MB-07811 | Drug Info | [543886] | |||
| ZYT-1 | Drug Info | [1572591] | |||
| Agonist | MGL-3196 | Drug Info | [532494] | ||
| rT3 | Drug Info | [531482] | |||
| tiratricol | Drug Info | [531482] | |||
| Pathways | |||||
| KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
| Thyroid hormone signaling pathway | |||||
| Pathway Interaction Database | RXR and RAR heterodimerization with other nuclear receptor | ||||
| Reactome | Nuclear Receptor transcription pathway | ||||
| WikiPathways | SIDS Susceptibility Pathways | ||||
| Hematopoietic Stem Cell Differentiation | |||||
| Nuclear Receptors | |||||
| References | |||||
| Ref 522631 | ClinicalTrials.gov (NCT00879112) Study of MB07811 in Subjects With Hypercholesterolemia. U.S. National Institutes of Health. | ||||
| Ref 523811 | ClinicalTrials.gov (NCT01543269) A Clinical Study to Evaluate the Safety,Tolerability and PK of ZYT1, Following Oral Administration in Healthy Volunteers. U.S. National Institutes of Health. | ||||
| Ref 532494 | Lipid lowering in healthy volunteers treated with multiple doses of MGL-3196, a liver-targeted thyroid hormone receptor-beta agonist. Atherosclerosis. 2013 Oct;230(2):373-80. | ||||
| Ref 539702 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2637). | ||||
| Ref 544305 | Bacterial biosensors for screening isoform-selective ligands for human thyroid receptors alpha-1 and beta-1. FEBS Open Bio. 2012; 2: 247-253. | ||||
| Ref 527532 | J Med Chem. 2005 May 5;48(9):3114-7.Thyroid receptor ligands. 3. Design and synthesis of 3,5-dihalo-4-alkoxyphenylalkanoic acids as indirect antagonists of the thyroid hormone receptor. | ||||
| Ref 527923 | Bioorg Med Chem Lett. 2006 Mar 1;16(5):1240-4. Epub 2005 Dec 9.Thyroid receptor ligands. Part 5: novel bicyclic agonist ligands selective for the thyroid hormone receptor beta. | ||||
| Ref 528640 | Bioorg Med Chem Lett. 2007 Apr 1;17(7):2018-21. Epub 2007 Jan 13.Thyroid receptor ligands. Part 7: Indirect antagonists of the thyroid hormone receptor with improved affinity. | ||||
| Ref 529081 | J Med Chem. 2007 Nov 1;50(22):5269-80. Epub 2007 Oct 5.Inhibitors of the interaction of a thyroid hormone receptor and coactivators: preliminary structure-activity relationships. | ||||
| Ref 530166 | J Med Chem. 2009 Jul 9;52(13):3892-901.Improvement of pharmacological properties of irreversible thyroid receptor coactivator binding inhibitors. | ||||
| Ref 531482 | Binding of 3,5,3'-triiodothyronine (T3) and its analogs to the in vitro translational products of c-erbA protooncogenes: differences in the affinity of the alpha- and beta-forms for the acetic acid analog and failure of the human testis and kidney alpha-2 products to bind T3. Mol Endocrinol. 1990 Feb;4(2):227-34. | ||||
| Ref 532494 | Lipid lowering in healthy volunteers treated with multiple doses of MGL-3196, a liver-targeted thyroid hormone receptor-beta agonist. Atherosclerosis. 2013 Oct;230(2):373-80. | ||||
| Ref 543886 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 589). | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.