Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T07806
|
||||
| Former ID |
TTDS00099
|
||||
| Target Name |
5-hydroxytryptamine 1B receptor
|
||||
| Gene Name |
HTR1B
|
||||
| Synonyms |
5-HT-1B; 5-HT-1D-beta; 5-HT1B receptor; S12; Serotonin 1D beta receptor; Serotonin receptor; Serotonin receptor 1B; HTR1B
|
||||
| Target Type |
Successful
|
||||
| Disease | Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42] | ||||
| Aggressive non-hodgkin's lymphoma [ICD9: 200, 201, 202, 202.8, 208.9; ICD10: C81, C81-C86, C82-C85, C91-C95] | |||||
| Chronic schizophrenics [ICD9: 295; ICD10: F20] | |||||
| Migraine headaches [ICD9: 346; ICD10: G43] | |||||
| Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32] | |||||
| Mood disorder [ICD10: F30-F39] | |||||
| Migraine [ICD9: 346; ICD10: G43] | |||||
| Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
| Psychotic disorders [ICD9: 290-299; ICD10: F20-F29] | |||||
| Severe mood disorders [ICD9: 296; ICD10: F30-F39] | |||||
| Function |
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances, such as lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Regulates the release of 5-hydroxytryptamine, dopamine and acetylcholine in the brain, and thereby affects neural activity, nociceptive processing, pain perception, mood and behavior. Besides, plays a role in vasoconstriction of cerebral arteries.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T07806
|
||||
| UniProt ID | |||||
| Sequence |
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL NSLINPIIYTMSNEDFKQAFHKLIRFKCTS |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Dihydroergotamine nasal | Drug Info | Approved | Migraine | [551730] |
| Eletriptan | Drug Info | Approved | Migraine | [536361], [540615] | |
| Fluphenazine | Drug Info | Approved | Psychotic disorders | [536507], [539303] | |
| Frovatriptan | Drug Info | Approved | Migraine headaches | [536361], [542203] | |
| Naratriptan | Drug Info | Approved | Migraine headaches | [467741], [536361] | |
| Prolixin decanoate | Drug Info | Approved | Chronic schizophrenics | [538477] | |
| Zolmitriptan | Drug Info | Approved | Migraine | [538555], [541265] | |
| Eltoprazine | Drug Info | Phase 2 | Aggressive non-hodgkin's lymphoma | [523309] | |
| NXN-188 | Drug Info | Phase 2 | Migraine | [522692] | |
| [N-methyl-3H(3)]AZ-10419369 | Drug Info | Phase 1 | Mood disorder | [522971], [540197] | |
| Donitriptan | Drug Info | Preclinical | Migraine | [540538], [547009] | |
| Elzasonan hydrochloride | Drug Info | Discontinued in Phase 2 | Severe mood disorders | [536580] | |
| IS-159 | Drug Info | Discontinued in Phase 2 | Migraine | [545995] | |
| Anpirtoline | Drug Info | Terminated | Pain | [528148] | |
| AZD-1134 | Drug Info | Terminated | Anxiety disorder | [547616] | |
| CGS-12066B | Drug Info | Terminated | Anxiety disorder | [538669], [546046] | |
| F-12682 | Drug Info | Terminated | Major depressive disorder | [546890] | |
| GR-127935 | Drug Info | Terminated | Major depressive disorder | [538876], [545301] | |
| L-775606 | Drug Info | Terminated | Discovery agent | [538680], [546600] | |
| VR-147 | Drug Info | Terminated | Migraine | [548264] | |
| Inhibitor | (+/-)-nantenine | Drug Info | [530558] | ||
| 1-(3-(pentafluorosulfanyl)phenyl)propan-2-amine | Drug Info | [529013] | |||
| 1-(7-Methoxy-naphthalen-2-yl)-piperazine | Drug Info | [534528] | |||
| 1-Naphthalen-2-yl-piperazine | Drug Info | [534528] | |||
| 2-(5-Thiophen-2-yl-1H-indol-3-yl)-ethylamine | Drug Info | [525792] | |||
| 5-amino-3-(N-methylpiperidin-4-yl)-1H-indole | Drug Info | [529496] | |||
| 5-Ethyl-3-(2-pyrrolidin-1-yl-ethyl)-1H-indole | Drug Info | [525845] | |||
| 5-Isopropyl-3-(2-pyrrolidin-1-yl-ethyl)-1H-indole | Drug Info | [525845] | |||
| A-987306 | Drug Info | [529789] | |||
| L-747201 | Drug Info | [534500] | |||
| L-775606 | Drug Info | [534500] | |||
| SEROTONIN | Drug Info | [529789] | |||
| WAY-466 | Drug Info | [527381] | |||
| [2-(5-Ethyl-1H-indol-3-yl)-ethyl]-dimethyl-amine | Drug Info | [525845] | |||
| Antagonist | (R)-flurocarazolol | Drug Info | [526124] | ||
| (S)-flurocarazolol | Drug Info | [526124] | |||
| 5-OH-DPAT | Drug Info | [527317] | |||
| 9-OH-risperidone | Drug Info | [534281] | |||
| AZD-1134 | Drug Info | [530096], [551730] | |||
| F-12682 | Drug Info | [546891], [551730] | |||
| GR55562 | Drug Info | [534909] | |||
| metergoline | Drug Info | [534239] | |||
| SB 224289 | Drug Info | [534909] | |||
| SB 272183 | Drug Info | [526100] | |||
| SB 649915 | Drug Info | [527551] | |||
| SB 714786 | Drug Info | [527551] | |||
| SB236057 | Drug Info | [525557] | |||
| [3H]GR 125,743 | Drug Info | [525563] | |||
| [N-methyl-3H(3)]AZ-10419369 | Drug Info | [533202], [551730] | |||
| Agonist | 1-naphthylpiperazine | Drug Info | [534239] | ||
| 2-methyl-5-HT | Drug Info | [527380] | |||
| 5-(nonyloxy)-tryptamine | Drug Info | [525602] | |||
| 5-CT | Drug Info | [527317] | |||
| 7-methoxy-1-naphthylpiperazine | Drug Info | [534528] | |||
| BRL-15572 | Drug Info | [534475] | |||
| CP-94,253 | Drug Info | [535394] | |||
| dipropyl-5-CT | Drug Info | [527380] | |||
| Eltoprazine | Drug Info | [551057], [551730] | |||
| L-772,405 | Drug Info | [525646] | |||
| lysergol | Drug Info | [534239] | |||
| Naratriptan | Drug Info | [536607] | |||
| SB 216641 | Drug Info | [534475] | |||
| SB 236057-A | Drug Info | [535363] | |||
| TFMPP | Drug Info | [534239] | |||
| [11C]AZ10419369 | Drug Info | [530875] | |||
| [125I]GTI | Drug Info | [533994] | |||
| [3H]8-OH-DPAT | Drug Info | [525553] | |||
| [3H]alniditan | Drug Info | [534635] | |||
| [3H]eletriptan | Drug Info | [525461] | |||
| [3H]sumatriptan | Drug Info | [525461] | |||
| Modulator | Anpirtoline | Drug Info | [528148] | ||
| CGS-12066B | Drug Info | ||||
| Dihydroergotamine nasal | Drug Info | [534635] | |||
| Donitriptan | Drug Info | ||||
| Eletriptan | Drug Info | [556264] | |||
| Elzasonan hydrochloride | Drug Info | ||||
| Fluphenazine | Drug Info | [556264] | |||
| Frovatriptan | Drug Info | [556264] | |||
| GR-127935 | Drug Info | ||||
| IS-159 | Drug Info | ||||
| NXN-188 | Drug Info | ||||
| Prolixin decanoate | Drug Info | [556264] | |||
| VR-147 | Drug Info | [550903], [551730] | |||
| Zolmitriptan | Drug Info | [556264] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | cAMP signaling pathway | ||||
| Neuroactive ligand-receptor interaction | |||||
| Serotonergic synapse | |||||
| PANTHER Pathway | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | ||||
| 5HT1 type receptor mediated signaling pathway | |||||
| Reactome | Serotonin receptors | ||||
| G alpha (i) signalling events | |||||
| WikiPathways | Serotonin HTR1 Group and FOS Pathway | ||||
| Monoamine GPCRs | |||||
| GPCRs, Class A Rhodopsin-like | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| References | |||||
| Ref 467741 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 45). | ||||
| Ref 522692 | ClinicalTrials.gov (NCT00920686) Study of NXN 188 for the Treatment of Migraine With Aura. U.S. National Institutes of Health. | ||||
| Ref 522971 | ClinicalTrials.gov (NCT01085123) Determine Central 5-HT1B Receptor Occupancy of ZOMIG Rapimelt (Zolmitriptan) in Healthy Male Volunteers. U.S. National Institutes of Health. | ||||
| Ref 523309 | ClinicalTrials.gov (NCT01266174) Effects of Eltoprazine on Cognitive Impairment Associated With Schizophrenia (CIAS) in Adults. U.S. National Institutes of Health. | ||||
| Ref 528148 | Effects of anpirtoline on regional serotonin synthesis in the rat brain: an autoradiographic study. Nucl Med Biol. 2006 Apr;33(3):325-32. Epub 2006 Mar 9. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 536507 | The antipsychotic drug, fluphenazine, effectively reverses mechanical allodynia in rat models of neuropathic pain. Psychopharmacology (Berl). 2008 Jan;195(4):559-68. Epub 2007 Sep 23. | ||||
| Ref 536580 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. Epub 2008 Jan 2. | ||||
| Ref 538477 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016727. | ||||
| Ref 538555 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 020768. | ||||
| Ref 538669 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 109). | ||||
| Ref 538680 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 114). | ||||
| Ref 538876 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 14). | ||||
| Ref 539303 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 204). | ||||
| Ref 540197 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3219). | ||||
| Ref 540538 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 39). | ||||
| Ref 540615 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 40). | ||||
| Ref 541265 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 60). | ||||
| Ref 542203 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7191). | ||||
| Ref 545301 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002743) | ||||
| Ref 545995 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005786) | ||||
| Ref 546046 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006033) | ||||
| Ref 546600 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009132) | ||||
| Ref 546890 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010898) | ||||
| Ref 547009 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012002) | ||||
| Ref 547616 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017898) | ||||
| Ref 525461 | Characterisation of the 5-HT receptor binding profile of eletriptan and kinetics of [3H]eletriptan binding at human 5-HT1B and 5-HT1D receptors. Eur J Pharmacol. 1999 Mar 5;368(2-3):259-68. | ||||
| Ref 525553 | Actions of roxindole at recombinant human dopamine D2, D3 and D4 and serotonin 5-HT1A, 5-HT1B and 5-HT1D receptors. Naunyn Schmiedebergs Arch Pharmacol. 1999 Jun;359(6):447-53. | ||||
| Ref 525557 | SB-236057, a selective 5-HT1B receptor inverse agonist, blocks the 5-HT human terminal autoreceptor. Eur J Pharmacol. 1999 Jun 30;375(1-3):359-65. | ||||
| Ref 525563 | Serotonin 5-HT1B and 5-HT1D receptors form homodimers when expressed alone and heterodimers when co-expressed. FEBS Lett. 1999 Jul 30;456(1):63-7. | ||||
| Ref 525602 | Identification of an amino acid residue important for binding of methiothepin and sumatriptan to the human 5-HT(1B) receptor. Eur J Pharmacol. 1999 Sep 10;380(2-3):171-81. | ||||
| Ref 525646 | 3-[3-(Piperidin-1-yl)propyl]indoles as highly selective h5-HT(1D) receptor agonists. J Med Chem. 1999 Dec 2;42(24):4981-5001. | ||||
| Ref 525792 | Bioorg Med Chem Lett. 2000 May 1;10(9):903-5.5-Thienyltryptamine derivatives as serotonin 5-HT1B/1D receptor agonists: potential treatments for migraine. | ||||
| Ref 525845 | Bioorg Med Chem Lett. 2000 Aug 7;10(15):1707-9.5-Alkyltryptamine derivatives as highly selective and potent 5-HT1D receptor agonists. | ||||
| Ref 526100 | SB-272183, a selective 5-HT(1A), 5-HT(1B) and 5-HT(1D) receptor antagonist in native tissue. Br J Pharmacol. 2001 Jul;133(6):797-806. | ||||
| Ref 526124 | The in vitro pharmacology of the beta-adrenergic receptor pet ligand (s)-fluorocarazolol reveals high affinity for cloned beta-adrenergic receptors and moderate affinity for the human 5-HT1A receptor. Psychopharmacology (Berl). 2001 Aug;157(1):111-4. | ||||
| Ref 527317 | Mouse 5HT1B serotonin receptor: cloning, functional expression, and localization in motor control centers. Proc Natl Acad Sci U S A. 1992 Apr 1;89(7):3020-4. | ||||
| Ref 527380 | Human serotonin 1D receptor is encoded by a subfamily of two distinct genes: 5-HT1D alpha and 5-HT1D beta. Proc Natl Acad Sci U S A. 1992 Apr 15;89(8):3630-4. | ||||
| Ref 527381 | J Med Chem. 2005 Jan 27;48(2):353-6.Discovery of 5-arylsulfonamido-3-(pyrrolidin-2-ylmethyl)-1H-indole derivatives as potent, selective 5-HT6 receptor agonists and antagonists. | ||||
| Ref 527551 | Discovery of the first potent, selective 5-hydroxytryptamine1D receptor antagonist. J Med Chem. 2005 May 19;48(10):3478-80. | ||||
| Ref 528148 | Effects of anpirtoline on regional serotonin synthesis in the rat brain: an autoradiographic study. Nucl Med Biol. 2006 Apr;33(3):325-32. Epub 2006 Mar 9. | ||||
| Ref 529013 | Bioorg Med Chem. 2007 Nov 1;15(21):6659-66. Epub 2007 Aug 15.The synthesis and biological activity of pentafluorosulfanyl analogs of fluoxetine, fenfluramine, and norfenfluramine. | ||||
| Ref 529496 | J Med Chem. 2008 Jun 26;51(12):3609-16. Epub 2008 May 29.Designing selective, high affinity ligands of 5-HT1D receptor by covalent dimerization of 5-HT1F ligands derived from 4-fluoro-N-[3-(1-methyl-4-piperidinyl)-1H-indol-5-yl]benzamide. | ||||
| Ref 529789 | J Med Chem. 2008 Nov 27;51(22):7094-8.cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain responses against carrageenan-induced hyperalgesia. | ||||
| Ref 530096 | N-methyl-3H3AZ10419369 binding to the 5-HT1B receptor: in vitro characterization and in vivo receptor occupancy. J Pharmacol Exp Ther. 2009 Jul;330(1):342-51. | ||||
| Ref 530558 | Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. | ||||
| Ref 530875 | Quantitative analysis of [11C]AZ10419369 binding to 5-HT1B receptors in human brain. J Cereb Blood Flow Metab. 2011 Jan;31(1):113-23. | ||||
| Ref 533202 | 5-HT1B and other related serotonergic proteins are altered in APPswe mutation. Neurosci Lett. 2015 May 6;594:137-43. | ||||
| Ref 533994 | Autoradiographic characterisation and localisation of 5-HT1D compared to 5-HT1B binding sites in rat brain. Naunyn Schmiedebergs Arch Pharmacol. 1993 Jun;347(6):569-82. | ||||
| Ref 534239 | Two amino acid differences in the sixth transmembrane domain are partially responsible for the pharmacological differences between the 5-HT1D beta and 5-HT1E 5-hydroxytryptamine receptors. J Neurochem. 1996 Nov;67(5):2096-103. | ||||
| Ref 534281 | Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl). 1996 Mar;124(1-2):57-73. | ||||
| Ref 534475 | SB-216641 and BRL-15572--compounds to pharmacologically discriminate h5-HT1B and h5-HT1D receptors. Naunyn Schmiedebergs Arch Pharmacol. 1997 Sep;356(3):312-20. | ||||
| Ref 534500 | J Med Chem. 1997 Oct 24;40(22):3501-3.Selective, orally active 5-HT1D receptor agonists as potential antimigraine agents. | ||||
| Ref 534528 | J Med Chem. 1997 Nov 21;40(24):3974-8.5-HT1B receptor antagonist properties of novel arylpiperazide derivatives of 1-naphthylpiperazine. | ||||
| Ref 534635 | Br J Pharmacol. 1998 Apr;123(8):1655-65.Agonistic properties of alniditan, sumatriptan and dihydroergotamine on human 5-HT1B and 5-HT1D receptors expressed in various mammalian cell lines. | ||||
| Ref 534909 | 5-hydroxytryptamine receptors mediating contraction in human small muscular pulmonary arteries: importance of the 5-HT1B receptor. Br J Pharmacol. 1999 Oct;128(3):730-4. | ||||
| Ref 535363 | SB-236057-A: a selective 5-HT1B receptor inverse agonist. CNS Drug Rev. 2001 Winter;7(4):433-44. | ||||
| Ref 535394 | Anxiogenic-like effect of serotonin(1B) receptor stimulation in the rat elevated plus-maze. Pharmacol Biochem Behav. 2002 Apr;71(4):581-7. | ||||
| Ref 546891 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010898) | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.