Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T46365
|
||||
| Former ID |
TTDR00116
|
||||
| Target Name |
M-phase inducer phosphatase 2
|
||||
| Gene Name |
CDC25B
|
||||
| Synonyms |
Cdc25B phosphatase; Dual specificity phosphatase Cdc25B; CDC25B
|
||||
| Target Type |
Discontinued
|
||||
| Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
| Function |
Functionsas a dosage-dependent inducer in mitotic control. It is a tyrosine protein phosphatase required for progression of the cell cycle. It directly dephosphorylates cdc2 and activate its kinase activity.
|
||||
| BioChemical Class |
Phosphoric monoester hydrolases
|
||||
| Target Validation |
T46365
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.1.3.48
|
||||
| Sequence |
MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMH
DLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMD PHMAEQTFEQAIQAASRIIRNEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEA GSGAASSSGEDKENDGFVFKMPWKPTHPSSTHALAEWASRREAFAQRPSSAPDLMCLSPD RKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLKDDDAVPPGMESLISAPLVKT LEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPPEEQ QEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAFLLQTVDGKHQDLKYISPETM VALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKR VILIFHCEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQ DYRPMNHEAFKDELKTFRLKTRSWAGERSRRELCSRLQDQ |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | 3-isopropyl-4-(phenylamino)naphthalene-1,2-dione | Drug Info | [527986] | ||
| 3-isopropyl-4-(phenylthio)naphthalene-1,2-dione | Drug Info | [527986] | |||
| 3-isopropyl-4-phenylnaphthalene-1,2-dione | Drug Info | [527986] | |||
| 4-(p-toluidino)-3-isopropylnaphthalene-1,2-dione | Drug Info | [527986] | |||
| 4-ethoxynaphthalene-1,2-dione | Drug Info | [529817] | |||
| 5,6,7,8-tetrahydroanthracene-1,4-dione | Drug Info | [529817] | |||
| 6,7-dibromoquinoline-5,8-dione | Drug Info | [529691] | |||
| ADOCIAQUINONE B | Drug Info | [529691] | |||
| ANTHRAQUINONE | Drug Info | [529817] | |||
| Beta-Mercaptoethanol | Drug Info | [551393] | |||
| Cysteine Sulfenic Acid | Drug Info | [551391] | |||
| Cysteinesulfonic Acid | Drug Info | [551393] | |||
| Double Oxidized Cysteine | Drug Info | [551393] | |||
| JUGLONE | Drug Info | [529817] | |||
| Methyl Mercury Ion | Drug Info | [551393] | |||
| MX-7065 | Drug Info | [551830] | |||
| NSC-95397 | Drug Info | [529691] | |||
| Pathways | |||||
| KEGG Pathway | MAPK signaling pathway | ||||
| Cell cycle | |||||
| Progesterone-mediated oocyte maturation | |||||
| MicroRNAs in cancer | |||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| TGF_beta_Receptor Signaling Pathway | |||||
| Wnt Signaling Pathway | |||||
| Pathway Interaction Database | PLK1 signaling events | ||||
| FOXM1 transcription factor network | |||||
| p38 signaling mediated by MAPKAP kinases | |||||
| Aurora A signaling | |||||
| Reactome | Cyclin B2 mediated events | ||||
| Cyclin A/B1 associated events during G2/M transition | |||||
| Cdk2-associated events at S phase entry | |||||
| WikiPathways | Senescence and Autophagy in Cancer | ||||
| MAPK Signaling Pathway | |||||
| Retinoblastoma (RB) in Cancer | |||||
| Prostate Cancer | |||||
| Integrated Breast Cancer Pathway | |||||
| Integrated Cancer pathway | |||||
| Mitotic G2-G2/M phases | |||||
| Cell Cycle | |||||
| References | |||||
| Ref 527986 | Bioorg Med Chem Lett. 2006 Apr 1;16(7):1905-8. Epub 2006 Jan 24.Synthesis of miltirone analogues as inhibitors of Cdc25 phosphatases. | ||||
| Ref 529691 | Bioorg Med Chem. 2008 Oct 1;16(19):9040-9. Epub 2008 Aug 7.Novel naphthoquinone and quinolinedione inhibitors of CDC25 phosphatase activity with antiproliferative properties. | ||||
| Ref 529817 | Bioorg Med Chem. 2009 Mar 15;17(6):2276-81. Epub 2008 Nov 8.Bioactivities of simplified adociaquinone B and naphthoquinone derivatives against Cdc25B, MKP-1, and MKP-3 phosphatases. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.