Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T79961
|
||||
| Former ID |
TTDI01755
|
||||
| Target Name |
Acetylcholine receptor
|
||||
| Gene Name |
CHRM5
|
||||
| Synonyms |
CHRM1; Muscarinic acetylcholine receptor M1; CHRM5
|
||||
| Target Type |
Successful
|
||||
| Disease | Amnesia [ICD10: F04] | ||||
| Allergic rhinitis [ICD9: 472.0, 477, 995.3; ICD10: J00, J30, J31.0, T78.4] | |||||
| Brain diseases [ICD10: G00-G99] | |||||
| Colitis [ICD9: 556.9; ICD10: K50-K52] | |||||
| Cognitive disorders [ICD9: 290-294, 294.0, 780.09, 780.9, 780.93; ICD10: F01-F07, F04, F05, R41.3] | |||||
| Central and peripheral nervous diseases [ICD10: G96.9] | |||||
| Chronic obstructive pulmonary disease [ICD9: 490-492, 494-496; ICD10: J40-J44, J47] | |||||
| Dysmenorrhea [ICD9: 625.3; ICD10: N94.4-N94.6] | |||||
| Irritable bowel syndrome [ICD9: 564.1, 787.91; ICD10: A09, K58, K59.1] | |||||
| Myasthenia gravis [ICD9: 358; ICD10: G70.0] | |||||
| Neurological disease [ICD9: 338, 338.2, 410, 782.3,780; ICD10: I21, I22, R52, R52.1-R52.2, R60.9, G89] | |||||
| Schizophrenia [ICD9: 295; ICD10: F20] | |||||
| Stomach ulcer [ICD10: K25-K27] | |||||
| Urinary incontinence [ICD9: 788.3; ICD10: N39.3, N39.4, R32] | |||||
| Function |
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| UniProt ID | |||||
| Sequence |
MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQ
LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMN LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPL DECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAE KRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQL TTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPN YLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNP NPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLG YWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP |
||||
| Structure |
1Y5P; 1Y5T; 1Y6C
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Belladonna | Drug Info | Approved | Colitis | [551871] |
| Butylscopolamine | Drug Info | Approved | Dysmenorrhea | [551871] | |
| Choline alfoscerate | Drug Info | Approved | Amnesia | [551871] | |
| Emepronium | Drug Info | Approved | Urinary incontinence | [551871] | |
| Prifinium | Drug Info | Approved | Irritable bowel syndrome | [551871] | |
| Propiverine | Drug Info | Approved | Urinary incontinence | [551871] | |
| Pramiracetam | Drug Info | Approved (orphan drug) | Brain diseases | [551871] | |
| Dexpirronium | Drug Info | Phase 1 | Chronic obstructive pulmonary disease | [548759] | |
| BMS-181168 | Drug Info | Discontinued in Phase 2 | Cognitive disorders | [544848] | |
| DDP-200 | Drug Info | Discontinued in Phase 2 | Urinary incontinence | [547888] | |
| FK-584 | Drug Info | Discontinued in Phase 2 | Central and peripheral nervous diseases | [546161] | |
| AM-831 | Drug Info | Discontinued in Phase 1 | Schizophrenia | [547459] | |
| SU-740 | Drug Info | Terminated | Stomach ulcer | [545835] | |
| Blocker (channel blocker) | A-867744 | Drug Info | [530093] | ||
| NS1738 | Drug Info | [528946] | |||
| Antagonist | alpha-conotoxin AuIB | Drug Info | [543844] | ||
| alpha-conotoxin GI | Drug Info | [543844] | |||
| alpha-conotoxin PnIA | Drug Info | [543844] | |||
| Dexpirronium | Drug Info | [543844] | |||
| Propiverine | Drug Info | [525517], [551871] | |||
| Agonist | AM-831 | Drug Info | [550322] | ||
| [125I]epibatidine | Drug Info | [543844] | |||
| [3H]cytisine | Drug Info | [543844] | |||
| [3H]epibatidine | Drug Info | [543844] | |||
| Modulator | Belladonna | Drug Info | [530253], [551871] | ||
| BHT-3034 | Drug Info | [543844] | |||
| BMS-181168 | Drug Info | [534294] | |||
| Butylscopolamine | Drug Info | [533864], [551871] | |||
| Choline alfoscerate | Drug Info | [543844] | |||
| CRTX-070 | Drug Info | [543844] | |||
| DDP-200 | Drug Info | [550848] | |||
| Emepronium | Drug Info | [533659], [551871] | |||
| FK-584 | Drug Info | [550892] | |||
| JWB-1-84-1 | Drug Info | [543844] | |||
| Pramiracetam | Drug Info | [550025], [551871] | |||
| Prifinium | Drug Info | [533658], [551871] | |||
| Recombinant botulinum toxin | Drug Info | [543844] | |||
| SU-740 | Drug Info | [551752] | |||
| Topical anticholinergics | Drug Info | [543844] | |||
| Pathways | |||||
| KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
| Reactome | Muscarinic acetylcholine receptors | ||||
| Acetylcholine regulates insulin secretion | |||||
| Highly sodium permeable acetylcholine nicotinic receptors | |||||
| Highly calcium permeable postsynaptic nicotinic acetylcholine receptors | |||||
| WikiPathways | Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell | ||||
| References | |||||
| Ref 544848 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001318) | ||||
| Ref 545835 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004989) | ||||
| Ref 546161 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006686) | ||||
| Ref 547459 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016551) | ||||
| Ref 547888 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020170) | ||||
| Ref 525517 | Affinity profiles of various muscarinic antagonists for cloned human muscarinic acetylcholine receptor (mAChR) subtypes and mAChRs in rat heart and submandibular gland. Life Sci. 1999;64(25):2351-8. | ||||
| Ref 528946 | An allosteric modulator of the alpha7 nicotinic acetylcholine receptor possessing cognition-enhancing properties in vivo. J Pharmacol Exp Ther. 2007 Oct;323(1):294-307. Epub 2007 Jul 11. | ||||
| Ref 530093 | J Pharmacol Exp Ther. 2009 Jul;330(1):257-67. Epub 2009 Apr 23.In vitro pharmacological characterization of a novel allosteric modulator of alpha 7 neuronal acetylcholine receptor, 4-(5-(4-chlorophenyl)-2-methyl-3-propionyl-1H-pyrrol-1-yl)benzenesulfonamide (A-867744), exhibiting unique pharmacological profile. | ||||
| Ref 530253 | Plasma level of atropine after accidental ingestion of Atropa belladonna. Clin Toxicol (Phila). 2009 Jul;47(6):602-4. | ||||
| Ref 533658 | Ligand binding properties of muscarinic acetylcholine receptor subtypes (m1-m5) expressed in baculovirus-infected insect cells. J Pharmacol Exp Ther. 1995 Jul;274(1):378-84. | ||||
| Ref 533659 | Classification of the presynaptic muscarinic receptor subtype that regulates 3H-acetylcholine secretion in the guinea pig urinary bladder in vitro. J Pharmacol Exp Ther. 1995 Jul;274(1):458-68. | ||||
| Ref 533864 | Comparison of pharmacological effects of L- and DL-n-butyl-scopolamine in rat uterus. Yao Xue Xue Bao. 1994;29(1):24-7. | ||||
| Ref 534294 | Efficacy and safety of BMY 21,502 in Alzheimer disease. Ann Pharmacother. 1996 Dec;30(12):1376-80. | ||||
| Ref 543844 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 467). | ||||
| Ref 550025 | Some neurochemical properties of pramiracetam (CI-879), a new cognition-enhancing agent. Article first published online: 5 OCT 2004. | ||||
| Ref 550848 | CA patent application no. 753057, Sustained release oral dosage forms of an r-baclofen prodrug. | ||||
| Ref 550892 | US patent application no. 2005,0261,328, Pharmaceutical composition comprising beta-3-adrenoceptor-agonists and antimuscarinic agents. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.