Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T62193
|
||||
Former ID |
TTDS00361
|
||||
Target Name |
Aromatic-L-amino-acid decarboxylase
|
||||
Gene Name |
DDC
|
||||
Synonyms |
AADC; DOPA decarboxylase; DDC
|
||||
Target Type |
Successful
|
||||
Disease | Parkinson's disease [ICD9: 332; ICD10: G20] | ||||
Vitamin B6 deficiency [ICD9: 266.1; ICD10: E53.1] | |||||
Function |
Catalyzes the decarboxylation of L-3,4- dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.
|
||||
BioChemical Class |
Carbon-carbon lyase
|
||||
Target Validation |
T62193
|
||||
UniProt ID | |||||
EC Number |
EC 4.1.1.28
|
||||
Sequence |
MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDV
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD WLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIM EKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMV ATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFN PHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSL KMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVN EALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE |
||||
Drugs and Mode of Action | |||||
Drug(s) | Carbidopa | Drug Info | Approved | Parkinson's disease | [468222], [536121] |
Vitamin B6 | Drug Info | Approved | Vitamin B6 deficiency | [538432], [551871] | |
Benserazide | Drug Info | Phase 3 | Discovery agent | [468214], [521673] | |
Patrome | Drug Info | Phase 3 | Parkinson's disease | [529140] | |
AV-201 | Drug Info | Phase 2 | Parkinson's disease | [551892] | |
ProSavin | Drug Info | Phase 1/2 | Parkinson's disease | [524296] | |
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
BioCyc Pathway | Superpathway of tryptophan utilization | ||||
Tryptophan degradation via tryptamine | |||||
Serotonin and melatonin biosynthesis | |||||
Catecholamine biosynthesis | |||||
KEGG Pathway | Histidine metabolism | ||||
Tyrosine metabolism | |||||
Phenylalanine metabolism | |||||
Tryptophan metabolism | |||||
Metabolic pathways | |||||
Serotonergic synapse | |||||
Dopaminergic synapse | |||||
Cocaine addiction | |||||
Amphetamine addiction | |||||
Alcoholism | |||||
PANTHER Pathway | Adrenaline and noradrenaline biosynthesis | ||||
5-Hydroxytryptamine biosynthesis | |||||
Dopamine receptor mediated signaling pathway | |||||
Nicotine pharmacodynamics pathway | |||||
PathWhiz Pathway | Catecholamine Biosynthesis | ||||
Tyrosine Metabolism | |||||
Tryptophan Metabolism | |||||
WikiPathways | SIDS Susceptibility Pathways | ||||
Biogenic Amine Synthesis | |||||
Tryptophan metabolism | |||||
Dopaminergic Neurogenesis | |||||
Metabolism of amino acids and derivatives | |||||
Dopamine metabolism | |||||
Parkinsons Disease Pathway | |||||
Nicotine Activity on Dopaminergic Neurons | |||||
References | |||||
Ref 468214 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5150). | ||||
Ref 468222 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5159). | ||||
Ref 521673 | ClinicalTrials.gov (NCT00144209) Assess Efficacy and Safety of the Dopamine Agonist Pramipexole Versus Levodopa / Benserazide (Madopar DR) in Patients With Restless Legs Syndrome. U.S. National Institutes of Health. | ||||
Ref 524296 | ClinicalTrials.gov (NCT01856439) Long Term Safety and Efficacy Study of ProSavin in Parkinson's Disease. U.S. National Institutes of Health. | ||||
Ref 529140 | Dopamine dysregulation syndrome, addiction and behavioral changes in Parkinson's disease. Parkinsonism Relat Disord. 2008;14(4):273-80. Epub 2007 Nov 7. | ||||
Ref 536121 | Emerging drugs for restless legs syndrome. Expert Opin Emerg Drugs. 2005 Aug;10(3):537-52. | ||||
Ref 538432 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 010598. | ||||
Ref 525931 | Clin Cancer Res. 2000 Nov;6(11):4365-72.The aromatic-L-amino acid decarboxylase inhibitor carbidopa is selectively cytotoxic to human pulmonary carcinoid and small cell lung carcinoma cells. | ||||
Ref 535173 | Catechol-O-methyltransferase inhibitors in the management of Parkinson's disease. Semin Neurol. 2001;21(1):15-22. | ||||
Ref 535831 | Activation of an adrenergic pro-drug through sequential stereoselective action of tandem target enzymes. Biochem Biophys Res Commun. 1992 Nov 30;189(1):33-9. | ||||
Ref 536101 | Functional COMT variant predicts response to high dose pyridoxine in Parkinson's disease. Am J Med Genet B Neuropsychiatr Genet. 2005 Aug 5;137B(1):1-4. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.