Target General Infomation
Target ID
T62193
Former ID
TTDS00361
Target Name
Aromatic-L-amino-acid decarboxylase
Gene Name
DDC
Synonyms
AADC; DOPA decarboxylase; DDC
Target Type
Successful
Disease Parkinson's disease [ICD9: 332; ICD10: G20]
Vitamin B6 deficiency [ICD9: 266.1; ICD10: E53.1]
Function
Catalyzes the decarboxylation of L-3,4- dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.
BioChemical Class
Carbon-carbon lyase
Target Validation
T62193
UniProt ID
EC Number
EC 4.1.1.28
Sequence
MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDV
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIM
EKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMV
ATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVN
EALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE
Drugs and Mode of Action
Drug(s) Carbidopa Drug Info Approved Parkinson's disease [468222], [536121]
Vitamin B6 Drug Info Approved Vitamin B6 deficiency [538432], [551871]
Benserazide Drug Info Phase 3 Discovery agent [468214], [521673]
Patrome Drug Info Phase 3 Parkinson's disease [529140]
AV-201 Drug Info Phase 2 Parkinson's disease [551892]
ProSavin Drug Info Phase 1/2 Parkinson's disease [524296]
Inhibitor 3-hydroxybenzylhydrazine Drug Info [543396]
Benserazide Drug Info [535173]
Carbidopa Drug Info [535173]
Modulator AV-201 Drug Info
Patrome Drug Info [525931]
ProSavin Drug Info [551478]
Activator Noradrenalone (arterenone) Drug Info [535831]
Cofactor Vitamin B6 Drug Info [536101]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
BioCyc Pathway Superpathway of tryptophan utilization
Tryptophan degradation via tryptamine
Serotonin and melatonin biosynthesis
Catecholamine biosynthesis
KEGG Pathway Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
PANTHER Pathway Adrenaline and noradrenaline biosynthesis
5-Hydroxytryptamine biosynthesis
Dopamine receptor mediated signaling pathway
Nicotine pharmacodynamics pathway
PathWhiz Pathway Catecholamine Biosynthesis
Tyrosine Metabolism
Tryptophan Metabolism
WikiPathways SIDS Susceptibility Pathways
Biogenic Amine Synthesis
Tryptophan metabolism
Dopaminergic Neurogenesis
Metabolism of amino acids and derivatives
Dopamine metabolism
Parkinsons Disease Pathway
Nicotine Activity on Dopaminergic Neurons
References
Ref 468214(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5150).
Ref 468222(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5159).
Ref 521673ClinicalTrials.gov (NCT00144209) Assess Efficacy and Safety of the Dopamine Agonist Pramipexole Versus Levodopa / Benserazide (Madopar DR) in Patients With Restless Legs Syndrome. U.S. National Institutes of Health.
Ref 524296ClinicalTrials.gov (NCT01856439) Long Term Safety and Efficacy Study of ProSavin in Parkinson's Disease. U.S. National Institutes of Health.
Ref 529140Dopamine dysregulation syndrome, addiction and behavioral changes in Parkinson's disease. Parkinsonism Relat Disord. 2008;14(4):273-80. Epub 2007 Nov 7.
Ref 536121Emerging drugs for restless legs syndrome. Expert Opin Emerg Drugs. 2005 Aug;10(3):537-52.
Ref 538432FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 010598.
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 551892Clinical pipeline report, company report or official report of Genzyme.
Ref 525931Clin Cancer Res. 2000 Nov;6(11):4365-72.The aromatic-L-amino acid decarboxylase inhibitor carbidopa is selectively cytotoxic to human pulmonary carcinoid and small cell lung carcinoma cells.
Ref 535173Catechol-O-methyltransferase inhibitors in the management of Parkinson's disease. Semin Neurol. 2001;21(1):15-22.
Ref 535831Activation of an adrenergic pro-drug through sequential stereoselective action of tandem target enzymes. Biochem Biophys Res Commun. 1992 Nov 30;189(1):33-9.
Ref 536101Functional COMT variant predicts response to high dose pyridoxine in Parkinson's disease. Am J Med Genet B Neuropsychiatr Genet. 2005 Aug 5;137B(1):1-4.
Ref 543396(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1271).
Ref 551478Clinical pipeline report, company report or official report of Oxford BioMedica.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.