Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T86591
|
||||
Former ID |
TTDS00340
|
||||
Target Name |
Peroxisome proliferator activated receptor alpha
|
||||
Gene Name |
PPARA
|
||||
Synonyms |
PPAR-alpha; PPARalpha; Peroxisome proliferater-activated receptor alpha; PPARA
|
||||
Target Type |
Successful
|
||||
Disease | Arteriosclerosis [ICD9: 440; ICD10: I70] | ||||
Cardiovascular disorder [ICD10: I00-I99] | |||||
Dyslipidaemias [ICD9: 272; ICD10: E78] | |||||
Diabetes [ICD9: 253.5, 588.1; ICD10: E23.2, N25.1] | |||||
Gout [ICD9: 274.00274.1274.8274.9; ICD10: M10] | |||||
Hyperlipoproteinemia; Atherosclerosis [ICD9:272.0-272.4, 414.0, 440; ICD10: E78, I70] | |||||
Heart failure [ICD9: 428; ICD10: I50] | |||||
High cholesterol level; High triglyceride level [ICD9: 272.0, 272.1; ICD10: E78.0, E78.1, E78.2, E78.3] | |||||
Hyperlipidaemia [ICD9: 272.0-272.4; ICD10: E78] | |||||
Lipid metabolism disorder [ICD10: E75-E78] | |||||
Metabolic disorders [ICD9: 270-279; ICD10: E70-E89] | |||||
Non-alcoholic fatty liver disease [ICD9: 571.8; ICD10: K76.0] | |||||
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
Type 1 diabetes [ICD9: 250; ICD10: E10] | |||||
Type 2 diabetes [ICD9: 250; ICD10: E11] | |||||
Unspecified [ICD code not available] | |||||
Function |
Ligand-activated transcription factor. Key regulator of lipid metabolism. Activated by the endogenous ligand 1-palmitoyl- 2-oleoyl-sn-glycerol-3-phosphocholine (16:0/18:1-GPC). Activated by oleylethanolamide, a naturally occurring lipid that regulates satiety. Receptor for peroxisome proliferators such as hypolipidemic drugs and fatty acids. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the ACOX1 and P450 genes. Transactivation activity requires heterodimerization with RXRA and is antagonized by NR2C2. May be required for the propagation of clock information to metabolic pathways regulated by PER2.
|
||||
BioChemical Class |
Zinc-finger
|
||||
Target Validation |
T86591
|
||||
UniProt ID | |||||
Sequence |
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSC
PGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACE GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE KAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFV IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY |
||||
Drugs and Mode of Action | |||||
Drug(s) | Bezafibrate | Drug Info | Approved | Hyperlipidaemia | [539733], [550550] |
Ciprofibrate | Drug Info | Approved | Hyperlipoproteinemia; Atherosclerosis | [540377], [550550], [551871] | |
Fenofibrate | Drug Info | Approved | High cholesterol level; High triglyceride level | [536740], [542197] | |
CS-038 | Drug Info | Phase 3 | Type 2 diabetes | [524807] | |
Imiglitazar | Drug Info | Phase 3 | Type 2 diabetes | [525383], [539741] | |
K-877 | Drug Info | Phase 3 | Lipid metabolism disorder | [549140] | |
Lobeglitazone | Drug Info | Phase 3 | Diabetes | [531686] | |
MURAGLITAZAR | Drug Info | Phase 3 | Discovery agent | [521615] | |
Ragaglitazar | Drug Info | Phase 3 | Type 1 diabetes | [526845], [539729] | |
TESAGLITAZAR | Drug Info | Phase 3 | Type 1 diabetes | [521734] | |
ZYH-1 | Drug Info | Phase 3 | Lipid metabolism disorder | [532516] | |
GFT-505 | Drug Info | Phase 2 | Type 2 diabetes | [548380] | |
GFT14 | Drug Info | Phase 2 | Hyperlipidaemia | [548300] | |
LY-518674 | Drug Info | Phase 2 | Diabetes | [521832], [539724] | |
Naveglitazar | Drug Info | Phase 2 | Diabetes | [521566] | |
ONO-5129 | Drug Info | Phase 2 | Diabetes | [521841] | |
ZYH-7 | Drug Info | Phase 2 | Lipid metabolism disorder | [523803] | |
AVE0897 | Drug Info | Phase 1 | Type 2 diabetes | [548128] | |
CDT-fenofibrate | Drug Info | Phase 1 | Hyperlipidaemia | [534742] | |
GW-409544 | Drug Info | Phase 1 | Hyperlipidaemia | [531939], [540380] | |
Oxeglitazar | Drug Info | Phase 1 | Gout | [531047] | |
MC-3001 | Drug Info | Preclinical | Lipid metabolism disorder | [548011] | |
MC-3002 | Drug Info | Preclinical | Metabolic disorders | [548000] | |
Romazarit | Drug Info | Preclinical | Rheumatoid arthritis | [544776] | |
Aleglitazar | Drug Info | Discontinued in Phase 3 | Type 2 diabetes | [542428], [547561] | |
AVE-0847 | Drug Info | Discontinued in Phase 2 | Hyperlipidaemia | [547944] | |
AVE-8134 | Drug Info | Discontinued in Phase 2 | Heart failure | [548007] | |
BM-17.0744 | Drug Info | Discontinued in Phase 2 | Type 1 diabetes | [546978] | |
GSK-677954 | Drug Info | Discontinued in Phase 2 | Non-alcoholic fatty liver disease | [536649] | |
Indeglitazar | Drug Info | Discontinued in Phase 2 | Type 2 diabetes | [548153] | |
KRP-101 | Drug Info | Discontinued in Phase 2 | Hyperlipidaemia | [547707] | |
MK-767 (KRP-297) | Drug Info | Discontinued in Phase 2 | Type 2 diabetes | [546825] | |
NS-220 | Drug Info | Discontinued in Phase 2 | Hyperlipidaemia | [539744], [547609] | |
Reglixane | Drug Info | Discontinued in Phase 2 | Diabetes | [546560] | |
Sodelglitazar | Drug Info | Discontinued in Phase 2 | Hyperlipidaemia | [547644] | |
AR-H049020 | Drug Info | Discontinued in Phase 1 | Type 1 diabetes | [547411] | |
DRF 10945 | Drug Info | Discontinued in Phase 1 | Hyperlipidaemia | [547933] | |
E-3030 | Drug Info | Discontinued in Phase 1 | Hyperlipidaemia | [548044] | |
LG-101280 | Drug Info | Discontinued in Phase 1 | Arteriosclerosis | [547284] | |
LY-929 | Drug Info | Discontinued in Phase 1 | Lipid metabolism disorder | [539723], [547284] | |
MP-136 | Drug Info | Discontinued in Phase 1 | Lipid metabolism disorder | [548975] | |
BVT-142 | Drug Info | Terminated | Type 2 diabetes | [527135] | |
CS-204 | Drug Info | Terminated | Metabolic disorders | [548591] | |
CS-207 | Drug Info | Terminated | Cardiovascular disorder | [548592] | |
KRP-105 | Drug Info | Terminated | Lipid metabolism disorder | [548566] | |
KRP-297 | Drug Info | Terminated | Hyperlipidaemia | [526192], [539743] | |
Sipoglitazar | Drug Info | Terminated | Diabetes | [532486] | |
Inhibitor | (9Z,12E)-12-nitrooctadeca-9,12-dienoic acid | Drug Info | [530350] | ||
(E)-12-Nitrooctadec-12-enoic Acid | Drug Info | [530350] | |||
(E)-13-Nitrooctadec-12-enoic Acid | Drug Info | [530350] | |||
BMS-687453 | Drug Info | [530777] | |||
Deoxy-Bigchap | Drug Info | [551393] | |||
GSK-9578 | Drug Info | [526879] | |||
L-165461 | Drug Info | [526582] | |||
L-796449 | Drug Info | [526582] | |||
PIRINIXIC ACID | Drug Info | [526707] | |||
Agonist | 8S-HETE | Drug Info | [533647] | ||
AD-5061 | Drug Info | [527124] | |||
Aleglitazar | Drug Info | [551607] | |||
AR-H049020 | Drug Info | [550118] | |||
AVE-8134 | Drug Info | [530192] | |||
AVE0897 | Drug Info | [549823] | |||
Bezafibrate | Drug Info | [537006] | |||
BVT-142 | Drug Info | [527135], [550926] | |||
CDT-fenofibrate | Drug Info | [534742] | |||
Ciprofibrate | Drug Info | [534997] | |||
CP-775146 | Drug Info | [529780] | |||
CS-204 | Drug Info | [544056] | |||
CS-207 | Drug Info | [548593] | |||
DB-900 | Drug Info | [550862] | |||
DRF 10945 | Drug Info | [544209] | |||
DRF 2519 | Drug Info | [527076] | |||
eicosatetranoic acid | Drug Info | [534452] | |||
Fenofibrate | Drug Info | [534997] | |||
Fibrates | Drug Info | [536740] | |||
GFT14 | Drug Info | [548301] | |||
GSK-677954 | Drug Info | [536649] | |||
GW7647 | Drug Info | [526054] | |||
GW9578 | Drug Info | [534997] | |||
Indeglitazar | Drug Info | [529893] | |||
K-877 | Drug Info | [532380] | |||
KRP-101 | Drug Info | [529268], [530129] | |||
KRP-105 | Drug Info | [531722] | |||
Lobeglitazone | Drug Info | [531686] | |||
LY-465608 | Drug Info | [527060] | |||
LY-518674 | Drug Info | [529793] | |||
LY-929 | Drug Info | [550832] | |||
MC-3001 | Drug Info | [548012] | |||
MP-136 | Drug Info | [543889] | |||
N-oleoylethanolamide | Drug Info | [527561] | |||
NS-220 | Drug Info | [529786], [551871] | |||
pristanic acid | Drug Info | [525897] | |||
pterostilbene | Drug Info | [543889] | |||
reglitazar | Drug Info | [534829] | |||
Sodelglitazar | Drug Info | [531487] | |||
TZD18 | Drug Info | [526920] | |||
Modulator | AVE-0847 | Drug Info | |||
CS-038 | Drug Info | ||||
E-3030 | Drug Info | ||||
GFT-505 | Drug Info | ||||
GW-2331 | Drug Info | ||||
GW-409544 | Drug Info | [531939] | |||
Imiglitazar | Drug Info | [527124] | |||
KRP-297 | Drug Info | [526192] | |||
LG-101280 | Drug Info | [527514] | |||
LL-6531 | Drug Info | [543889] | |||
MC-3002 | Drug Info | [1572591] | |||
MK-767 (KRP-297) | Drug Info | [526645] | |||
MURAGLITAZAR | Drug Info | ||||
Naveglitazar | Drug Info | [528458] | |||
ONO-5129 | Drug Info | [1572591] | |||
Oxeglitazar | Drug Info | [531047] | |||
Ragaglitazar | Drug Info | [526845] | |||
Reglixane | Drug Info | [1572591] | |||
Romazarit | Drug Info | [544293] | |||
Sipoglitazar | Drug Info | [532486] | |||
TESAGLITAZAR | Drug Info | ||||
ZY H2 | Drug Info | [1572605] | |||
ZYH-1 | Drug Info | [532486] | |||
ZYH-7 | Drug Info | [543889] | |||
Activator | BM-17.0744 | Drug Info | [526404], [551871] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | PPAR signaling pathway | ||||
cAMP signaling pathway | |||||
Adipocytokine signaling pathway | |||||
Glucagon signaling pathway | |||||
Non-alcoholic fatty liver disease (NAFLD) | |||||
Hepatitis C | |||||
Pathway Interaction Database | RXR and RAR heterodimerization with other nuclear receptor | ||||
Reactome | RORA activates gene expression | ||||
CLOCK,NPAS2 activates circadian gene expression | |||||
PPARA activates gene expression | |||||
YAP1- and WWTR1 (TAZ)-stimulated gene expression | |||||
Transcriptional activation of mitochondrial biogenesis | |||||
Activation of gene expression by SREBF (SREBP) | |||||
Transcriptional regulation of white adipocyte differentiation | |||||
Nuclear Receptor transcription pathway | |||||
Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) | |||||
Circadian Clock | |||||
WikiPathways | Nuclear Receptors in Lipid Metabolism and Toxicity | ||||
Nuclear Receptors Meta-Pathway | |||||
Estrogen Receptor Pathway | |||||
PPAR Alpha Pathway | |||||
Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) | |||||
Transcriptional Regulation of White Adipocyte Differentiation | |||||
YAP1- and WWTR1 (TAZ)-stimulated gene expression | |||||
Activation of Gene Expression by SREBP (SREBF) | |||||
Adipogenesis | |||||
SREBF and miR33 in cholesterol and lipid homeostasis | |||||
Circadian Clock | |||||
Nuclear Receptors | |||||
References | |||||
Ref 521566 | ClinicalTrials.gov (NCT00065312) An Evaluation of an Oral Antidiabetic Agent for the Treatment of Type 2 Diabetes. U.S. National Institutes of Health. | ||||
Ref 521615 | ClinicalTrials.gov (NCT00094991) Mechanism of Action and Efficacy of Muraglitazar in Type 2 Diabetes. U.S. National Institutes of Health. | ||||
Ref 521734 | ClinicalTrials.gov (NCT00229710) GALLEX 9: Safety and Tolerability of Oral Tesaglitazar When Added to Insulin Therapy in Patients With Type 2 Diabetes. U.S. National Institutes of Health. | ||||
Ref 521832 | ClinicalTrials.gov (NCT00327002) A Mechanistic Study of the Effects of LY518674 on High-Density Lipoprotein Cholesterol (HDL-C) Metabolism. U.S. National Institutes of Health. | ||||
Ref 521841 | ClinicalTrials.gov (NCT00335712) Pilot Study of ONO-5129 in Patients With Type 2 Diabetes Mellitus. U.S. National Institutes of Health. | ||||
Ref 523803 | ClinicalTrials.gov (NCT01539616) A Clinical Trial to Evaluate the Safety and Efficacy of ZYH7 Compared to Fenofibrate in Patients With Dyslipidemia. U.S. National Institutes of Health. | ||||
Ref 524807 | ClinicalTrials.gov (NCT02173457) Study of Chiglitazar Compare With Sitagliptin in Type 2 Diabetes Patients. U.S. National Institutes of Health. | ||||
Ref 525383 | Medicinal Chemistry and Actions of Dual and Pan PPAR Modulators. Open Med Chem J. 2011;5(Suppl 2):93-8. | ||||
Ref 526845 | Ragaglitazar: the pharmacokinetics, pharmacodynamics, and tolerability of a novel dual PPAR alpha and gamma agonist in healthy subjects and patients with type 2 diabetes. J Clin Pharmacol. 2003 Nov;43(11):1244-56. | ||||
Ref 527135 | A new class of peroxisome proliferator-activated receptor agonists with a novel binding epitope shows antidiabetic effects. J Biol Chem. 2004 Sep 24;279(39):41124-30. Epub 2004 Jul 15. | ||||
Ref 531047 | Therapeutic potential of aleglitazar, a new dual PPAR-alpha/gamma agonist: implications for cardiovascular disease in patients with diabetes mellitus. Am J Cardiovasc Drugs. 2010;10(4):209-16. | ||||
Ref 531686 | Tolerability and pharmacokinetics of lobeglitazone (CKD-501), a peroxisome proliferator-activated receptor-gamma agonist: a single- and multiple-dose, double-blind, randomized control study in healthy male Korean subjects. Clin Ther. 2011 Nov;33(11):1819-30. | ||||
Ref 531939 | Design novel dual agonists for treating type-2 diabetes by targeting peroxisome proliferator-activated receptors with core hopping approach. PLoS One. 2012;7(6):e38546. | ||||
Ref 532486 | Pharmacokinetics, safety, and tolerability of saroglitazar (ZYH1), a predominantly PPARalpha agonist with moderate PPARgamma agonist activity in healthy human subjects. Clin Drug Investig. 2013 Nov;33(11):809-16. | ||||
Ref 532516 | A multicenter, prospective, randomized, double-blind study to evaluate the safety and efficacy of Saroglitazar 2 and 4??g compared with placebo in type 2 diabetes mellitus patients having hypertriglyceridemia not controlled with atorvastatin therapy (PRESS VI). Diabetes Technol Ther. 2014 Feb;16(2):63-71. | ||||
Ref 534742 | Mechanism of action of fibrates on lipid and lipoprotein metabolism. Circulation. 1998 Nov 10;98(19):2088-93. | ||||
Ref 536649 | Emerging drugs for non-alcoholic fatty liver disease. Expert Opin Emerg Drugs. 2008 Mar;13(1):145-58. | ||||
Ref 539723 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2657). | ||||
Ref 539724 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2658). | ||||
Ref 539729 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2664). | ||||
Ref 539733 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2668). | ||||
Ref 539741 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2675). | ||||
Ref 539743 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2677). | ||||
Ref 539744 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2678). | ||||
Ref 540377 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3438). | ||||
Ref 540380 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3440). | ||||
Ref 542197 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7186). | ||||
Ref 542428 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7405). | ||||
Ref 544776 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000969) | ||||
Ref 546560 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008953) | ||||
Ref 546825 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010490) | ||||
Ref 546978 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011739) | ||||
Ref 547284 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014823) | ||||
Ref 547411 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016001) | ||||
Ref 547561 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017317) | ||||
Ref 547609 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017798) | ||||
Ref 547644 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018093) | ||||
Ref 547707 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018628) | ||||
Ref 547933 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020522) | ||||
Ref 547944 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020608) | ||||
Ref 548000 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021065) | ||||
Ref 548007 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021122) | ||||
Ref 548011 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021175) | ||||
Ref 548044 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021476) | ||||
Ref 548128 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800022196) | ||||
Ref 548153 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800022483) | ||||
Ref 548300 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024296) | ||||
Ref 548380 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025107) | ||||
Ref 548566 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026674) | ||||
Ref 548591 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026847) | ||||
Ref 548592 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026848) | ||||
Ref 548975 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031057) | ||||
Ref 549140 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032781) | ||||
Ref 525897 | Pristanic acid and phytanic acid: naturally occurring ligands for the nuclear receptor peroxisome proliferator-activated receptor alpha. J Lipid Res. 2000 Nov;41(11):1801-7. | ||||
Ref 526054 | Identification of a subtype selective human PPARalpha agonist through parallel-array synthesis. Bioorg Med Chem Lett. 2001 May 7;11(9):1225-7. | ||||
Ref 526404 | Cardiac function and metabolism in Type 2 diabetic mice after treatment with BM 17.0744, a novel PPAR-alpha activator. Am J Physiol Heart Circ Physiol. 2002 Sep;283(3):H949-57. | ||||
Ref 526582 | Bioorg Med Chem Lett. 2003 Apr 7;13(7):1277-80.Phenylacetic acid derivatives as hPPAR agonists. | ||||
Ref 526707 | Bioorg Med Chem Lett. 2003 Oct 6;13(19):3185-90.O-arylmandelic acids as highly selective human PPAR alpha/gamma agonists. | ||||
Ref 526845 | Ragaglitazar: the pharmacokinetics, pharmacodynamics, and tolerability of a novel dual PPAR alpha and gamma agonist in healthy subjects and patients with type 2 diabetes. J Clin Pharmacol. 2003 Nov;43(11):1244-56. | ||||
Ref 526879 | J Med Chem. 2003 Nov 20;46(24):5121-4.Design and synthesis of a potent and selective triazolone-based peroxisome proliferator-activated receptor alpha agonist. | ||||
Ref 526920 | A novel peroxisome proliferator-activated receptor alpha/gamma dual agonist demonstrates favorable effects on lipid homeostasis. Endocrinology. 2004 Apr;145(4):1640-8. Epub 2003 Dec 30. | ||||
Ref 527060 | Design and synthesis of alpha-aryloxy-alpha-methylhydrocinnamic acids: a novel class of dual peroxisome proliferator-activated receptor alpha/gamma agonists. J Med Chem. 2004 May 6;47(10):2422-5. | ||||
Ref 527076 | Antidiabetic and hypolipidemic potential of DRF 2519--a dual activator of PPAR-alpha and PPAR-gamma. Eur J Pharmacol. 2004 May 3;491(2-3):195-206. | ||||
Ref 527124 | A novel oxyiminoalkanoic acid derivative, TAK-559, activates human peroxisome proliferator-activated receptor subtypes. Eur J Pharmacol. 2004 Jul 8;495(1):17-26. | ||||
Ref 527135 | A new class of peroxisome proliferator-activated receptor agonists with a novel binding epitope shows antidiabetic effects. J Biol Chem. 2004 Sep 24;279(39):41124-30. Epub 2004 Jul 15. | ||||
Ref 527514 | A peroxisome proliferator-activated receptor alpha/gamma dual agonist with a unique in vitro profile and potent glucose and lipid effects in rodent models of type 2 diabetes and dyslipidemia. Mol Endocrinol. 2005 Jun;19(6):1593-605. Epub 2005 Apr 14. | ||||
Ref 527561 | Oleoylethanolamide, an endogenous PPAR-alpha agonist, lowers body weight and hyperlipidemia in obese rats. Neuropharmacology. 2005 Jun;48(8):1147-53. Epub 2005 Apr 21. | ||||
Ref 528458 | The disposition and metabolism of naveglitazar, a peroxisome proliferator-activated receptor alpha-gamma dual, gamma-dominant agonist in mice, rats, and monkeys. Drug Metab Dispos. 2007 Jan;35(1):51-61. Epub 2006 Sep 29. | ||||
Ref 529268 | A novel PPARalpha agonist ameliorates insulin resistance in dogs fed a high-fat diet. Am J Physiol Endocrinol Metab. 2008 May;294(5):E833-40. | ||||
Ref 529780 | Molecular characterization of novel and selective peroxisome proliferator-activated receptor alpha agonists with robust hypolipidemic activity in vivo. Mol Pharmacol. 2009 Feb;75(2):296-306. | ||||
Ref 529786 | Modulation of PPAR receptor subtype selectivity of the ligands: aliphatic chain vs aromatic ring as a spacer between pharmacophore and the lipophilic moiety. Bioorg Med Chem Lett. 2008 Dec 15;18(24):6471-5. | ||||
Ref 529793 | Potent and selective PPAR-alpha agonist LY518674 upregulates both ApoA-I production and catabolism in human subjects with the metabolic syndrome. Arterioscler Thromb Vasc Biol. 2009 Jan;29(1):140-6. | ||||
Ref 529893 | Scaffold-based discovery of indeglitazar, a PPAR pan-active anti-diabetic agent. Proc Natl Acad Sci U S A. 2009 Jan 6;106(1):262-7. | ||||
Ref 530129 | Identification of a functional peroxisome proliferator-activated receptor (PPAR) response element (PPRE) in the human apolipoprotein A-IV gene. Biochem Pharmacol. 2009 Sep 1;78(5):523-30. | ||||
Ref 530192 | The peroxisome proliferator-activated receptor-alpha (PPAR-alpha) agonist, AVE8134, attenuates the progression of heart failure and increases survival in rats. Acta Pharmacol Sin. 2009 Jul;30(7):935-46. | ||||
Ref 530350 | J Med Chem. 2009 Aug 13;52(15):4631-9.Activation of peroxisome proliferator-activated receptor gamma (PPARgamma) by nitroalkene fatty acids: importance of nitration position and degree of unsaturation. | ||||
Ref 530777 | J Med Chem. 2010 Apr 8;53(7):2854-64.Discovery of an oxybenzylglycine based peroxisome proliferator activated receptor alpha selective agonist 2-((3-((2-(4-chlorophenyl)-5-methyloxazol-4-yl)methoxy)benzyl)(methoxycarbonyl)amino)acetic acid (BMS-687453). | ||||
Ref 531047 | Therapeutic potential of aleglitazar, a new dual PPAR-alpha/gamma agonist: implications for cardiovascular disease in patients with diabetes mellitus. Am J Cardiovasc Drugs. 2010;10(4):209-16. | ||||
Ref 531487 | Docking and molecular dynamics simulations of peroxisome proliferator activated receptors interacting with pan agonist sodelglitazar. Protein Pept Lett. 2011 Oct;18(10):1021-7. | ||||
Ref 531686 | Tolerability and pharmacokinetics of lobeglitazone (CKD-501), a peroxisome proliferator-activated receptor-gamma agonist: a single- and multiple-dose, double-blind, randomized control study in healthy male Korean subjects. Clin Ther. 2011 Nov;33(11):1819-30. | ||||
Ref 531722 | Discovery of cyclic amine-substituted benzoic acids as PPARalpha agonists. Bioorg Med Chem Lett. 2012 Jan 1;22(1):334-8. | ||||
Ref 531939 | Design novel dual agonists for treating type-2 diabetes by targeting peroxisome proliferator-activated receptors with core hopping approach. PLoS One. 2012;7(6):e38546. | ||||
Ref 532380 | Selective peroxisome proliferator-activated receptor alpha modulators (SPPARMalpha): the next generation of peroxisome proliferator-activated receptor alpha-agonists. Cardiovasc Diabetol. 2013 May 31;12:82. | ||||
Ref 532486 | Pharmacokinetics, safety, and tolerability of saroglitazar (ZYH1), a predominantly PPARalpha agonist with moderate PPARgamma agonist activity in healthy human subjects. Clin Drug Investig. 2013 Nov;33(11):809-16. | ||||
Ref 533647 | Differential activation of peroxisome proliferator-activated receptors by eicosanoids. J Biol Chem. 1995 Oct 13;270(41):23975-83. | ||||
Ref 534452 | PPAR alpha structure-function relationships derived from species-specific differences in responsiveness to hypolipidemic agents. Biol Chem. 1997 Jul;378(7):651-5. | ||||
Ref 534742 | Mechanism of action of fibrates on lipid and lipoprotein metabolism. Circulation. 1998 Nov 10;98(19):2088-93. | ||||
Ref 534829 | Pharmacological profiles of a novel oral antidiabetic agent, JTT-501, an isoxazolidinedione derivative. Eur J Pharmacol. 1999 Jan 8;364(2-3):211-9. | ||||
Ref 534997 | Peroxisome proliferator-activated receptor alpha activators improve insulin sensitivity and reduce adiposity. J Biol Chem. 2000 Jun 2;275(22):16638-42. | ||||
Ref 536649 | Emerging drugs for non-alcoholic fatty liver disease. Expert Opin Emerg Drugs. 2008 Mar;13(1):145-58. | ||||
Ref 537006 | Bezafibrate at clinically relevant doses decreases serum/liver triglycerides via down-regulation of sterol regulatory element-binding protein-1c in mice: a novel peroxisome proliferator-activated receptor alpha-independent mechanism. Mol Pharmacol. 2009 Apr;75(4):782-92. Epub 2009 Jan 5. | ||||
Ref 543889 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 593). | ||||
Ref 544056 | Peroxisome Proliferators-Activated Receptor (PPAR) Modulators and Metabolic Disorders. PPAR Res. 2008; 2008: 679137. | ||||
Ref 544209 | Peroxisome proliferator-activated receptors, metabolic syndrome and cardiovascular disease. Future Cardiol. 2010 September; 6(5): 657-691. | ||||
Ref 544293 | Fibrates as therapy for osteoarthritis and rheumatoid arthritis? A systematic review. Ther Adv Musculoskelet Dis. 2013 February; 5(1): 33-44. | ||||
Ref 548012 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021175) | ||||
Ref 548301 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024296) | ||||
Ref 548593 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026848) | ||||
Ref 550118 | CN patent application no. 100577175, Combination therapy comprising glucose reabsorption inhibitors and PPAR modulators. | ||||
Ref 550862 | CN patent application no. 102459215, 3-(4-aminophenyl)-2-furancarboxylic acid derivative and pharmaceutically acceptable salt thereof. | ||||
Ref 551871 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.