Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T28661
|
||||
| Former ID |
TTDS00389
|
||||
| Target Name |
Tubulin beta-2 chain
|
||||
| Gene Name |
TUBB4B
|
||||
| Synonyms |
Beta(II) isotype of Tubulin; Beta(II)-Tubulin; BetaII-Tubulin; TUBB4B
|
||||
| Target Type |
Successful
|
||||
| Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
| Function |
Tubulin is the major constituent of microtubules. It binds two moles of gtp, one at an exchangeable site on the beta chain and one at a nonexchangeable site on the alpha-chain.
|
||||
| Target Validation |
T28661
|
||||
| UniProt ID | |||||
| Sequence |
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS EYQQYQDATAEEEGEFEEEAEEEVA |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | 2'-amino-3,4,4',5-tetramethoxy-(Z)-stillbene | Drug Info | [528474] | ||
| 2,3'-diamino-3,4,4',5-tetramethoxy-(Z)-stillbene | Drug Info | [528474] | |||
| 2-amino-3,4',5-trimethoxy-(Z)-stillbene | Drug Info | [528474] | |||
| 3,4',5-trimethoxy-(Z)-stilbene | Drug Info | [528474] | |||
| 3,4,4',5-tetramethoxy-(Z)-stilbene | Drug Info | [528474] | |||
| 3-bromo-4,4',5-trimethoxy-(Z)-stilbene | Drug Info | [528474] | |||
| 6-ile-ustiloxin | Drug Info | [528306] | |||
| DOLASTATIN-10 | Drug Info | [528306] | |||
| N-(4-(3-(pyridin-2-yl)acryloyl)phenyl)acetamide | Drug Info | [528428] | |||
| USTILOXIN A | Drug Info | [528306] | |||
| Ustiloxin D | Drug Info | [528306] | |||
| Ustiloxin F | Drug Info | [528306] | |||
| Vinblastine | Drug Info | [535740] | |||
| References | |||||
| Ref 521453 | ClinicalTrials.gov (NCT00003677) Dolastatin 10 in Treating Patients With Metastatic Pancreatic Cancer. U.S. National Institutes of Health. | ||||
| Ref 528306 | Bioorg Med Chem Lett. 2006 Sep 15;16(18):4804-7. Epub 2006 Jul 11.Total synthesis and biological evaluation of ustiloxin natural products and two analogs. | ||||
| Ref 528428 | J Med Chem. 2006 Sep 21;49(19):5664-70.Design and biological evaluation of novel tubulin inhibitors as antimitotic agents using a pharmacophore binding model with tubulin. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.