Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T13259
|
||||
| Former ID |
TTDS00054
|
||||
| Target Name |
Succinate semialdehyde dehydrogenase, mitochondrial
|
||||
| Gene Name |
ALDH5A1
|
||||
| Synonyms |
NAD(+)-dependent succinic semialdehyde dehydrogenase; Succinic dehydrogenase; ALDH5A1
|
||||
| Target Type |
Successful
|
||||
| Disease | Dietary shortage [ICD9: 260-269; ICD10: E40-E46] | ||||
| Diagnostic imaging [ICD9: 331; ICD10: G30, I73.9] | |||||
| Function |
Catalyzes one step in the degradation of the inhibitory neurotransmitter gamma-aminobutyric acid (GABA).
|
||||
| BioChemical Class |
Oxidoreductases acting on aldehyde or oxo group of donors
|
||||
| Target Validation |
T13259
|
||||
| UniProt ID | |||||
| EC Number |
EC 1.2.1.24
|
||||
| Sequence |
MATCIWLRSCGARRLGSTFPGCRLRPRAGGLVPASGPAPGPAQLRCYAGRLAGLSAALLR
TDSFVGGRWLPAAATFPVQDPASGAALGMVADCGVREARAAVRAAYEAFCRWREVSAKER SSLLRKWYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIH TPAKDRRALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALAL AELASQAGIPSGVYNVIPCSRKNAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSV KRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAF AEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFF EPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWR VAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL |
||||
| Drugs and Mode of Action | |||||
| Pathways | |||||
| BioCyc Pathway | GABA shunt | ||||
| 4-aminobutyrate degradation | |||||
| KEGG Pathway | Alanine, aspartate and glutamate metabolism | ||||
| Butanoate metabolism | |||||
| Metabolic pathways | |||||
| PANTHER Pathway | Aminobutyrate degradation | ||||
| Gamma-aminobutyric acid synthesis | |||||
| PathWhiz Pathway | Glutamate Metabolism | ||||
| WikiPathways | GABA synthesis, release, reuptake and degradation | ||||
| References | |||||
| Ref 540490 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3637). | ||||
| Ref 527869 | Bioorg Med Chem Lett. 2006 Feb;16(3):592-5. Epub 2005 Nov 14.Inhibition of GABA shunt enzymes' activity by 4-hydroxybenzaldehyde derivatives. | ||||
| Ref 536076 | The GABA shunt: an attractive and potential therapeutic target in the treatment of epileptic disorders. Curr Drug Metab. 2005 Apr;6(2):127-39. | ||||
| Ref 536268 | Succinic semialdehyde couples stress response to quorum-sensing signal decay in Agrobacterium tumefaciens. Mol Microbiol. 2006 Oct;62(1):45-56. Epub 2006 Aug 30. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.