Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T04902
|
||||
Former ID |
TTDR00505
|
||||
Target Name |
Calpain
|
||||
Gene Name |
CAPN2
|
||||
Synonyms |
CANP; Calcium-activated neutral proteinase; CAPN2
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
Cerebral infarction [ICD10: I63] | |||||
Neurological disease [ICD9: 338, 338.2, 410, 782.3,780; ICD10: I21, I22, R52, R52.1-R52.2, R60.9, G89] | |||||
Trematode infection [ICD10: B66.9] | |||||
Function |
Calcium-regulated non-lysosomal thiol-protease which catalyze limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction.
|
||||
BioChemical Class |
Peptidase
|
||||
Target Validation |
T04902
|
||||
UniProt ID | |||||
EC Number |
EC 3.4.22.52
|
||||
Sequence |
MAGIAAKLAKDREAAEGLGSHDRAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGF
KELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEI LARVVPLNQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSAL LEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGC SIDITSAADSEAITFQKLVKGHAYSVTGAEEVESNGSLQKLIRIRNPWGEVEWTGRWNDN CPSWNTIDPEERERLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTK MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGESGCTFLVGLIQKHRRRQR KMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPG EYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRLFAQ LAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIIDFD NFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL |
||||
Structure |
1KFU; 1KFX; 2NQA; 1ZCM; 2ARY
|
||||
Drugs and Mode of Action | |||||
Drug(s) | ABT-957 | Drug Info | Phase 1 | Alzheimer disease | [524881] |
BITHIONOL | Drug Info | Withdrawn from market | Trematode infection | [539482], [551871] | |
Aloxistatin | Drug Info | Discontinued in Phase 3 | Neurological disease | [545202] | |
AK-295 | Drug Info | Terminated | Cerebral infarction | [546355] | |
MDL-2170 | Drug Info | Terminated | Discovery agent | [545554] | |
MDL-28170 | Drug Info | Terminated | Alzheimer disease | [545554] | |
SJA-6017 | Drug Info | Terminated | Discovery agent | [546570] | |
Inhibitor | (1-Benzyl-2-oxo-ethyl)-carbamic acid benzyl ester | Drug Info | [532033] | ||
3-(1H-Pyrrol-3-yl)-propionamide | Drug Info | [551300] | |||
A-558693 | Drug Info | [543595] | |||
AK-295 | Drug Info | [543595] | |||
Aloxistatin | Drug Info | [531262] | |||
AW-00430 | Drug Info | [531262] | |||
BITHIONOL | Drug Info | [531262] | |||
Calpastatin | Drug Info | [535733], [535764] | |||
compound 19 | Drug Info | [534224] | |||
compound 4b | Drug Info | [531089] | |||
compound 5a | Drug Info | [531089] | |||
DIHYDROXANTHOHUMOL | Drug Info | [531262] | |||
GNF-PF-4453 | Drug Info | [531262] | |||
MDL-2170 | Drug Info | [529828] | |||
MDL-28170 | Drug Info | [527555] | |||
mercaptoacrylate inhibitor of calpain 1 | Drug Info | [543595] | |||
N-(1-Benzyl-2-oxo-ethyl)-benzamide | Drug Info | [532033] | |||
SJA-6017 | Drug Info | [529551] | |||
Modulator | ABT-957 | Drug Info | [1572591] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
References | |||||
Ref 524881 | ClinicalTrials.gov (NCT02220738) Study to Evaluate the Safety, Tolerability, and Pharmacokinetics of ABT-957 in Subjects With Mild-to-Moderate Alzheimer's Disease on Stable Doses of Acetylcholinesterase Inhibitors. U.S. National Institutes of Health. | ||||
Ref 539482 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2338). | ||||
Ref 545202 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002441) | ||||
Ref 545554 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003692) | ||||
Ref 546355 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007674) | ||||
Ref 527555 | Bioorg Med Chem Lett. 2005 Jun 15;15(12):3034-8.Synthesis of a small library of diketopiperazines as potential inhibitors of calpain. | ||||
Ref 529551 | Bioorg Med Chem. 2008 Jul 15;16(14):6911-23. Epub 2008 May 27.Synthesis, biological evaluation and molecular modelling of N-heterocyclic dipeptide aldehydes as selective calpain inhibitors. | ||||
Ref 529828 | Bioorg Med Chem Lett. 2009 Jan 15;19(2):502-7. Epub 2008 Nov 14.Design and synthesis of 4-aryl-4-oxobutanoic acid amides as calpain inhibitors. | ||||
Ref 531089 | Peptidyl alpha-ketoamides with nucleobases, methylpiperazine, and dimethylaminoalkyl substituents as calpain inhibitors. J Med Chem. 2010 Sep 9;53(17):6326-36. | ||||
Ref 531262 | Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6. Epub 2010 Oct 21.In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). | ||||
Ref 532033 | J Med Chem. 1990 Jan;33(1):11-3.Alpha-diketone and alpha-keto ester derivatives of N-protected amino acids and peptides as novel inhibitors of cysteine and serine proteinases. | ||||
Ref 534224 | Novel peptidyl alpha-keto amide inhibitors of calpains and other cysteine proteases. J Med Chem. 1996 Sep 27;39(20):4089-98. | ||||
Ref 535733 | Calpain in the pathophysiology of spinal cord injury: neuroprotection with calpain inhibitors. Brain Res Brain Res Rev. 2003 May;42(2):169-85. | ||||
Ref 535764 | PEST sequences in the malaria parasite Plasmodium falciparum: a genomic study. Malar J. 2003 Jun 23;2:16. Epub 2003 Jun 23. | ||||
Ref 543595 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2336). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.