Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T20575
|
||||
| Former ID |
TTDR00763
|
||||
| Target Name |
C-C chemokine receptor type 8
|
||||
| Gene Name |
CCR8
|
||||
| Synonyms |
C-C CKR-8; CC-CKR-8; CC-chemokine receptor CHEMR1; CCR-8; CKR-L1; CMKBRL2; Chemokine receptor CCR8; Chemokine receptor-like 1; GPR-CY6; GPRCY6; TER1; CCR8
|
||||
| Target Type |
Discontinued
|
||||
| Disease | Psoriasis [ICD9: 696; ICD10: L40] | ||||
| Function |
Receptor for the chemokine CCL1/SCYA1/I-309. May regulate monocyte chemotaxis and thymic cell line apoptosis. Alternative coreceptor with CD4 for HIV-1 infection.
|
||||
| BioChemical Class |
GPCR rhodopsin
|
||||
| Target Validation |
T20575
|
||||
| UniProt ID | |||||
| Sequence |
MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVL
VVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSS MFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGV LQCYSFYNQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLV LIVVIASLLFWVPFNVVLFLTSLHSMHILDGCSISQQLTYATHVTEIISFTHCCVNPVIY AFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSSVDYIL |
||||
| Drugs and Mode of Action | |||||
| Antagonist | CCX-832 | Drug Info | [544435] | ||
| viral macrophage inflammatory protein-II | Drug Info | [525544] | |||
| Binder | I-309 | Drug Info | [538110] | ||
| Inhibitor | N-(4-phenylsulfamoyl-naphthalen-1-yl)-benzamide | Drug Info | [528647] | ||
| N-{4-[(benzylamino)sulfonyl]-1-naphthyl}benzamide | Drug Info | [528647] | |||
| Agonist | ZK 756326 | Drug Info | [527803] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
| Chemokine signaling pathway | |||||
| Viral carcinogenesis | |||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| PANTHER Pathway | Inflammation mediated by chemokine and cytokine signaling pathway | ||||
| Reactome | Chemokine receptors bind chemokines | ||||
| G alpha (i) signalling events | |||||
| WikiPathways | GPCRs, Class A Rhodopsin-like | ||||
| Peptide GPCRs | |||||
| GPCR ligand binding | |||||
| GPCR downstream signaling | |||||
| References | |||||
| Ref 525544 | HHV8-encoded vMIP-I selectively engages chemokine receptor CCR8. Agonist and antagonist profiles of viral chemokines. J Biol Chem. 1999 Jul 30;274(31):21569-74. | ||||
| Ref 527803 | Identification and characterization of a potent, selective nonpeptide agonist of the CC chemokine receptor CCR8. Mol Pharmacol. 2006 Jan;69(1):309-16. Epub 2005 Oct 12. | ||||
| Ref 528647 | J Med Chem. 2007 Feb 8;50(3):566-84.Design, synthesis, and evaluation of naphthalene-sulfonamide antagonists of human CCR8. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.