Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T14912
|
||||
Former ID |
TTDC00048
|
||||
Target Name |
Induced myeloid leukemia cell differentiation protein Mcl-1
|
||||
Gene Name |
MCL1
|
||||
Synonyms |
Bcl-2-related protein EAT/mcl1; mcl1/EAT; MCL1
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
Trematode infection [ICD10: B66.9] | |||||
BioChemical Class |
Bcl-2 family
|
||||
Target Validation |
T14912
|
||||
UniProt ID | |||||
Sequence |
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR |
||||
Drugs and Mode of Action | |||||
Inhibitor | ALTENUSIN | Drug Info | [531262] | ||
AMENTOFLAVONE | Drug Info | [531262] | |||
BITHIONOL | Drug Info | [531262] | |||
CEPHALOCHROMIN | Drug Info | [531262] | |||
EU-517 | Drug Info | [543733] | |||
GNF-PF-1591 | Drug Info | [531262] | |||
GNF-PF-3955 | Drug Info | [531262] | |||
GNF-PF-5134 | Drug Info | [531262] | |||
MORIN | Drug Info | [531262] | |||
NSC-180246 | Drug Info | [531262] | |||
NSC-66209 | Drug Info | [531262] | |||
Obatoclax | Drug Info | [531104] | |||
QEDIIRNIARHLAQVGDSMDR | Drug Info | [528469] | |||
ROSMARINIC ACID | Drug Info | [531262] | |||
SULFURETIN | Drug Info | [531262] | |||
TW-37 | Drug Info | [528469] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | PI3K-Akt signaling pathway | ||||
MicroRNAs in cancer | |||||
NetPath Pathway | TCR Signaling Pathway | ||||
PANTHER Pathway | Apoptosis signaling pathway | ||||
CCKR signaling map ST | |||||
Pathway Interaction Database | E2F transcription factor network | ||||
Direct p53 effectors | |||||
IL6-mediated signaling events | |||||
HIF-1-alpha transcription factor network | |||||
WikiPathways | Apoptosis | ||||
miR-targeted genes in muscle cell - TarBase | |||||
miR-targeted genes in lymphocytes - TarBase | |||||
miR-targeted genes in leukocytes - TarBase | |||||
Apoptosis Modulation and Signaling | |||||
References | |||||
Ref 531104 | Phase II study of obatoclax mesylate (GX15-070), a small-molecule BCL-2 family antagonist, for patients with myelofibrosis. Clin Lymphoma Myeloma Leuk. 2010 Aug;10(4):285-9. | ||||
Ref 528469 | J Med Chem. 2006 Oct 19;49(21):6139-42.Structure-based design of potent small-molecule inhibitors of anti-apoptotic Bcl-2 proteins. | ||||
Ref 531104 | Phase II study of obatoclax mesylate (GX15-070), a small-molecule BCL-2 family antagonist, for patients with myelofibrosis. Clin Lymphoma Myeloma Leuk. 2010 Aug;10(4):285-9. | ||||
Ref 531262 | Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6. Epub 2010 Oct 21.In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.