Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T28893
|
||||
Former ID |
TTDS00002
|
||||
Target Name |
Muscarinic acetylcholine receptor M1
|
||||
Gene Name |
CHRM1
|
||||
Synonyms |
M1 receptor; CHRM1
|
||||
Target Type |
Successful
|
||||
Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
Anesthesia [ICD9: 338; ICD10: R20.0] | |||||
Abdominal stomach pain; Irritable bowel syndrome [ICD9:789.0, 338, 780, 564.1, 787.91; ICD10: R10, G89, R52, A09, K58, K59.1] | |||||
Cognitive disorders [ICD9: 290-294, 294.0, 780.09, 780.9, 780.93; ICD10: F01-F07, F04, F05, R41.3] | |||||
Chronic obstructive pulmonary disease [ICD9: 490-492, 494-496; ICD10: J40-J44, J47] | |||||
Excessive sweating; Stomach ulcer [ICD9:780.8; ICD10: R61, K25-K27] | |||||
Functional bowel syndrome; Irritable bowel syndrome [ICD10: K58] | |||||
Glaucoma [ICD9: 365; ICD10: H40-H42] | |||||
Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51] | |||||
Neuropathic pain [ICD9: 356.0, 356.8; ICD10: G64, G90.0] | |||||
Neurological disease [ICD9: 338, 338.2, 410, 782.3,780; ICD10: I21, I22, R52, R52.1-R52.2, R60.9, G89] | |||||
Overactive bladder disorder [ICD9: 188, 596.51; ICD10: C67, N32.81] | |||||
Parkinson's disease [ICD9: 332; ICD10: G20] | |||||
Peptic ulcer [ICD9: 531-534; ICD10: K25-K27] | |||||
Parkinson's disease; Dystonia [ICD9:332; ICD10: G20, G24] | |||||
Parkinsonism; Extrapyramidal disorders secondary to neuroleptic drug therapy [ICD10: F06] | |||||
Schizophrenia [ICD9: 295; ICD10: F20] | |||||
Schizophrenia; Schizoaffective disorders [ICD9: 295, 295.70; ICD10: F20, F25] | |||||
Schizophrenia; Dementia [ICD9: 290-294, 295; ICD10: F01-F07, F20] | |||||
Seborrhea [ICD10: L21] | |||||
Urinary incontinence [ICD9: 788.3; ICD10: N39.3, N39.4, R32] | |||||
Visceral spasms [ICD10: R25.2] | |||||
Unspecified [ICD code not available] | |||||
Function |
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
Target Validation |
T28893
|
||||
UniProt ID | |||||
Sequence |
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL
GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL |
||||
Drugs and Mode of Action | |||||
Drug(s) | ACECLIDINE | Drug Info | Approved | Glaucoma | [539906], [551871] |
Benztropine | Drug Info | Approved | Parkinson's disease | [538165], [542590] | |
Biperiden | Drug Info | Approved | Parkinsonism; Extrapyramidal disorders secondary to neuroleptic drug therapy | [551871] | |
Clidinium | Drug Info | Approved | Abdominal stomach pain; Irritable bowel syndrome | [540498], [550751], [551871] | |
Cycrimine | Drug Info | Approved | Parkinson's disease | [550740] | |
Dicyclomine | Drug Info | Approved | Functional bowel syndrome; Irritable bowel syndrome | [551871] | |
Diphemanil Methylsulfate | Drug Info | Approved | Peptic ulcer | [550746] | |
Fesoterodine fumarate | Drug Info | Approved | Overactive bladder disorder | [529941] | |
Glycopyrrolate | Drug Info | Approved | Anesthesia | [538189], [542483] | |
Metixene | Drug Info | Approved | Parkinson's disease | [542248], [550770] | |
Oxyphenonium | Drug Info | Approved | Visceral spasms | [551871] | |
Pirenzepine | Drug Info | Approved | Peptic ulcer | [535729], [540243] | |
Propantheline | Drug Info | Approved | Excessive sweating; Stomach ulcer | [538344], [540253], [551871] | |
SMT-D002 | Drug Info | Approved | Seborrhea | [551707] | |
Trihexyphenidyl | Drug Info | Approved | Parkinson's disease; Dystonia | [536923], [542338], [551871] | |
Darotropium + 642444 | Drug Info | Phase 3 | Chronic obstructive pulmonary disease | [523399] | |
Nebracetam | Drug Info | Phase 3 | Parkinson's disease | [526312] | |
(S)-oxybutynin | Drug Info | Phase 2 | Urinary incontinence | [525400] | |
FP-1097 | Drug Info | Phase 2 | Urinary incontinence | [547822] | |
N-DESMETHYLCLOZAPINE | Drug Info | Phase 2 | Schizophrenia; Schizoaffective disorders | [540289] | |
NGX-267 | Drug Info | Phase 2 | Schizophrenia | [522264] | |
SR-46559A | Drug Info | Phase 2 | Cognitive disorders | [544940] | |
Xanomeline tartrate | Drug Info | Phase 2 | Parkinson's disease | [531668] | |
AC-262271 | Drug Info | Phase 1 | Glaucoma | [549229] | |
Arecoline | Drug Info | Phase 1 | Parkinson's disease | [525796], [526115], [527244], [539971] | |
AZD-6088 | Drug Info | Phase 1 | Neuropathic pain | [522711], [542767] | |
GSK1034702 | Drug Info | Phase 1 | Schizophrenia; Dementia | [548788] | |
MCD-386 | Drug Info | Phase 1 | Alzheimer disease | [546687] | |
Thiopilocarpine | Drug Info | Phase 1 | Cognitive disorders | [526908] | |
Telenzepine | Drug Info | Discontinued in Preregistration | Chronic obstructive pulmonary disease | [544690] | |
Darotropium | Drug Info | Discontinued in Phase 2 | Chronic obstructive pulmonary disease | [525365] | |
Declopramide | Drug Info | Discontinued in Phase 2 | Inflammatory bowel disease | [546239] | |
Rispenzepine | Drug Info | Discontinued in Phase 2 | Chronic obstructive pulmonary disease | [545564] | |
Talsaclidine fumarate | Drug Info | Discontinued in Phase 2 | Alzheimer disease | [545043] | |
YM-796 | Drug Info | Discontinued in Phase 2 | Cognitive disorders | [539895], [544855] | |
PD-151832 | Drug Info | Discontinued in Phase 1/2 | Parkinson's disease | [546217] | |
ITAMELINE | Drug Info | Discontinued in Phase 1 | Cognitive disorders | [545662] | |
Sabcomeline | Drug Info | Discontinued in Phase 1 | Discovery agent | [540062], [545592] | |
SDZ-210-086 | Drug Info | Discontinued in Phase 1 | Cognitive disorders | [544969] | |
TAZOMELINE | Drug Info | Discontinued in Phase 1 | Cognitive disorders | [546138] | |
AC-260584 | Drug Info | Terminated | Schizophrenia | [540298], [547460] | |
Alvameline | Drug Info | Terminated | Alzheimer disease | [534674] | |
HIMBACINE | Drug Info | Terminated | Discovery agent | [540212], [546219] | |
WAY-132983 | Drug Info | Terminated | Discovery agent | [546686] | |
Antagonist | (S)-oxybutynin | Drug Info | [530541] | ||
Benztropine | Drug Info | [536453], [536690] | |||
Biperiden | Drug Info | [535016] | |||
Clidinium | Drug Info | [537371] | |||
Dicyclomine | Drug Info | [537482], [537630] | |||
FP-1097 | Drug Info | [549828] | |||
Glycopyrrolate | Drug Info | [535754], [536471] | |||
Oxyphenonium | Drug Info | [534888] | |||
Pirenzepine | Drug Info | [535794], [537295] | |||
Propantheline | Drug Info | [536001] | |||
Rispenzepine | Drug Info | [537849] | |||
Trihexyphenidyl | Drug Info | [536802] | |||
Inhibitor | 1'-Benzyl-3-phenyl-[3,4']bipiperidinyl-2,6-dione | Drug Info | [533345] | ||
1,1-diphenyl-2-(3-tropanyl)ethanol | Drug Info | [530266] | |||
1-Methyl-1-(4-pyrrolidin-1-yl-but-2-ynyl)-urea | Drug Info | [527029] | |||
2,8-Dimethyl-1-oxa-8-aza-spiro[4.5]decan-3-one | Drug Info | [534723] | |||
2-(4-Diethylamino-but-2-ynyl)-isoindole-1,3-dione | Drug Info | [551341] | |||
2-Methyl-6-pyrrolidin-1-yl-hex-4-ynal oxime | Drug Info | [551235] | |||
3-(3-benzylamino)-piperidin-2-one | Drug Info | [528735] | |||
3-Methyl-7-pyrrolidin-1-yl-hept-5-yn-2-one | Drug Info | [551235] | |||
3-Tetrazol-2-yl-1-aza-bicyclo[2.2.2]octane | Drug Info | [527344] | |||
3alpha-(bis-chloro-phenylmethoxy)tropane | Drug Info | [528473] | |||
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [531079] | |||
6-Dimethylamino-2-methyl-hex-4-ynal oxime | Drug Info | [551235] | |||
7-Dimethylamino-3-methyl-hept-5-yn-2-one | Drug Info | [551235] | |||
7-Dimethylamino-hept-5-yn-2-one | Drug Info | [551235] | |||
7-Pyrrolidin-1-yl-hept-5-yn-2-one | Drug Info | [551235] | |||
A-987306 | Drug Info | [529789] | |||
ACECLIDINE | Drug Info | [534044] | |||
Acetic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester | Drug Info | [534645] | |||
AMINOBENZTROPINE | Drug Info | [534349] | |||
Arecoline | Drug Info | [551393] | |||
Benzoic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester | Drug Info | [525826] | |||
Bo(15)PZ | Drug Info | [527889] | |||
BRL-55473 | Drug Info | [551234] | |||
CARAMIPEN | Drug Info | [529957] | |||
CREMASTRINE | Drug Info | [527523] | |||
DIFLUOROBENZTROPINE | Drug Info | [528473] | |||
FLUMEZAPINE | Drug Info | [533165] | |||
FM1-10 | Drug Info | [529178] | |||
FM1-43 | Drug Info | [529178] | |||
GNF-PF-5618 | Drug Info | [527653] | |||
HIMBACINE | Drug Info | [527126] | |||
ISOCLOZAPINE | Drug Info | [530313] | |||
ISOLOXAPINE | Drug Info | [533577] | |||
N-(4-Dimethylamino-but-2-ynyl)-N-methyl-acetamide | Drug Info | [551235] | |||
N-methoxyquinuclidine-3-carboximidoyl chloride | Drug Info | [551234] | |||
N-methoxyquinuclidine-3-carboximidoyl fluoride | Drug Info | [551234] | |||
Propionic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester | Drug Info | [525826] | |||
R-dimethindene | Drug Info | [530300] | |||
RR(17)PZ | Drug Info | [527889] | |||
SULFOARECOLINE | Drug Info | [533450] | |||
Agonist | AC-260584 | Drug Info | [537030] | ||
AC-262271 | Drug Info | [550343] | |||
AC-42 | Drug Info | [537030] | |||
AF150(S) | Drug Info | [535833], [536601] | |||
AZD-6088 | Drug Info | [544266] | |||
BQCA | Drug Info | [540839] | |||
Darotropium | Drug Info | [550963] | |||
Darotropium + 642444 | Drug Info | [550963] | |||
GSK1034702 | Drug Info | [550963] | |||
ITAMELINE | Drug Info | [551871] | |||
LY-593039 | Drug Info | [537030] | |||
MCD-386 | Drug Info | [527660] | |||
Nebracetam | Drug Info | [530866] | |||
NGX-267 | Drug Info | [537030] | |||
PD-151832 | Drug Info | [551871] | |||
Sabcomeline | Drug Info | [537030] | |||
SDZ-210-086 | Drug Info | [533965] | |||
SMT-D002 | Drug Info | [527286] | |||
SR-46559A | Drug Info | [551871] | |||
Talsaclidine fumarate | Drug Info | [535511], [537030] | |||
TAZOMELINE | Drug Info | [551871] | |||
Thiopilocarpine | Drug Info | [526908] | |||
WAY-132983 | Drug Info | [535511], [537030] | |||
Xanomeline tartrate | Drug Info | [537030], [538104] | |||
Modulator | Alvameline | Drug Info | [534674] | ||
DAU-5750 | Drug Info | ||||
DAU-5884 | Drug Info | ||||
DAU-6202 | Drug Info | ||||
Declopramide | Drug Info | [525463] | |||
Diphemanil Methylsulfate | Drug Info | [556264] | |||
Fesoterodine fumarate | Drug Info | [551871] | |||
hexocyclium | Drug Info | ||||
Metixene | Drug Info | ||||
N-DESMETHYLCLOZAPINE | Drug Info | ||||
Telenzepine | Drug Info | [533879] | |||
YM-796 | Drug Info | ||||
Binder | Cycrimine | Drug Info | [537692] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Calcium signaling pathway | ||||
cAMP signaling pathway | |||||
Neuroactive ligand-receptor interaction | |||||
PI3K-Akt signaling pathway | |||||
Cholinergic synapse | |||||
Regulation of actin cytoskeleton | |||||
PANTHER Pathway | Alzheimer disease-amyloid secretase pathway | ||||
Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway | |||||
Muscarinic acetylcholine receptor 1 and 3 signaling pathway | |||||
Reactome | Muscarinic acetylcholine receptors | ||||
G alpha (q) signalling events | |||||
WikiPathways | Monoamine GPCRs | ||||
Calcium Regulation in the Cardiac Cell | |||||
Regulation of Actin Cytoskeleton | |||||
GPCRs, Class A Rhodopsin-like | |||||
Gastrin-CREB signalling pathway via PKC and MAPK | |||||
Secretion of Hydrochloric Acid in Parietal Cells | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
References | |||||
Ref 522264 | ClinicalTrials.gov (NCT00637793) Study of NGX267 Oral Capsules in Patients With Xerostomia Associated With Sjorgren's Syndrome. U.S. National Institutes of Health. | ||||
Ref 522711 | ClinicalTrials.gov (NCT00931541) AZD6088 Single Ascending Dose Study. U.S. National Institutes of Health. | ||||
Ref 523399 | ClinicalTrials.gov (NCT01316900) 24-week Trial Comparing GSK573719/GW642444 With GW642444 and With Tiotropium in Chronic Obstructive Pulmonary Disease. U.S. National Institutes of Health. | ||||
Ref 525365 | Medicinal chemistry and therapeutic potential of muscarinic M3 antagonists. Med Res Rev. 2009 Nov;29(6):867-902. | ||||
Ref 525400 | A phase 2, randomized, double-blind, efficacy and safety study of oxybutynin vaginal ring for alleviation of overactive bladder symptoms in women. J Urol. 2014 Apr;191(4):1014-21. | ||||
Ref 525796 | Arecoline excites rat locus coeruleus neurons by activating the M2-muscarinic receptor. Chin J Physiol. 2000 Mar 31;43(1):23-8. | ||||
Ref 526115 | M1 receptor activation is a requirement for arecoline analgesia. Farmaco. 2001 May-Jul;56(5-7):383-5. | ||||
Ref 526312 | Nefiracetam ameliorates associative learning impairment in the scopolamine-injected older rabbit. Med Sci Monit. 2002 Apr;8(4):BR105-12. | ||||
Ref 526908 | SDZ ENS 163, a selective muscarinic M1 receptor agonist, facilitates the induction of long-term potentiation in rat hippocampal slices. Eur J Pharmacol. 1992 Nov 3;222(1):21-5. | ||||
Ref 527244 | Arecoline excites the colonic smooth muscle motility via M3 receptor in rabbits. Chin J Physiol. 2004 Jun 30;47(2):89-94. | ||||
Ref 531668 | The M1/M4 preferring agonist xanomeline is analgesic in rodent models of chronic inflammatory and neuropathic pain via central site of action. Pain. 2011 Dec;152(12):2852-60. | ||||
Ref 534674 | In vivo muscarinic cholinergic mediated effects of Lu 25-109, a M1 agonist and M2/M3 antagonist in vitro. Psychopharmacology (Berl). 1998 Jun;137(3):233-40. | ||||
Ref 535729 | Autonomic modulation during acute myocardial ischemia by low-dose pirenzepine in conscious dogs with a healed myocardial infarction: a comparison with beta-adrenergic blockade. J Cardiovasc Pharmacol. 2003 May;41(5):671-7. | ||||
Ref 536923 | Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42. | ||||
Ref 538165 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040103. | ||||
Ref 538189 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040568. | ||||
Ref 538344 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 080927. | ||||
Ref 539895 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 287). | ||||
Ref 539906 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 288). | ||||
Ref 539971 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 296). | ||||
Ref 540062 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 306). | ||||
Ref 540212 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 324). | ||||
Ref 540243 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 328). | ||||
Ref 540253 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 329). | ||||
Ref 540289 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 333). | ||||
Ref 540298 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 334). | ||||
Ref 540498 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 366). | ||||
Ref 542248 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7232). | ||||
Ref 542338 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7315). | ||||
Ref 542483 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7459). | ||||
Ref 542590 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7601). | ||||
Ref 542767 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7822). | ||||
Ref 544690 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000603) | ||||
Ref 544855 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001332) | ||||
Ref 544940 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001599) | ||||
Ref 544969 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001734) | ||||
Ref 545043 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001956) | ||||
Ref 545564 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003718) | ||||
Ref 545592 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003824) | ||||
Ref 545662 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004062) | ||||
Ref 546138 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006554) | ||||
Ref 546217 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006926) | ||||
Ref 546219 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006949) | ||||
Ref 546239 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007055) | ||||
Ref 546686 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009638) | ||||
Ref 546687 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009639) | ||||
Ref 547460 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016553) | ||||
Ref 547822 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800019662) | ||||
Ref 548788 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028844) | ||||
Ref 525463 | Pharmacokinetics and central nervous system toxicity of declopramide (3-chloroprocainamide) in rats and mice. Anticancer Drugs. 1999 Jan;10(1):79-88. | ||||
Ref 525826 | J Med Chem. 2000 Jun 29;43(13):2514-22.6beta-Acyloxy(nor)tropanes: affinities for antagonist/agonist binding sites on transfected and native muscarinic receptors. | ||||
Ref 526908 | SDZ ENS 163, a selective muscarinic M1 receptor agonist, facilitates the induction of long-term potentiation in rat hippocampal slices. Eur J Pharmacol. 1992 Nov 3;222(1):21-5. | ||||
Ref 527029 | J Med Chem. 1992 Aug 21;35(17):3270-9.Urea and 2-imidazolidone derivatives of the muscarinic agents oxotremorine and N-methyl-N-(1-methyl-4-pyrrolidino-2-butynyl)acetamide. | ||||
Ref 527126 | Bioorg Med Chem Lett. 2004 Aug 2;14(15):3967-70.Himbacine analogs as muscarinic receptor antagonists--effects of tether and heterocyclic variations. | ||||
Ref 527286 | Demonstration of bladder selective muscarinic receptor binding by intravesical oxybutynin to treat overactive bladder. J Urol. 2004 Nov;172(5 Pt 1):2059-64. | ||||
Ref 527344 | J Med Chem. 1992 Apr 3;35(7):1280-90.Synthesis and muscarinic activities of quinuclidin-3-yltriazole and -tetrazole derivatives. | ||||
Ref 527523 | J Nat Prod. 2005 Apr;68(4):572-3.Cremastrine, a pyrrolizidine alkaloid from Cremastra appendiculata. | ||||
Ref 527653 | J Nat Prod. 2005 Jul;68(7):1061-5.Nocardimicins A, B, C, D, E, and F, siderophores with muscarinic M3 receptor inhibiting activity from Nocardia sp. TP-A0674. | ||||
Ref 527660 | The processing of the selective M1 agonist CDD-0102-J by human hepatic drug metabolizing enzymes. Am J Ther. 2005 Jul-Aug;12(4):300-5. | ||||
Ref 527889 | J Med Chem. 2005 Dec 1;48(24):7847-59.On the use of nonfluorescent dye labeled ligands in FRET-based receptor binding studies. | ||||
Ref 528473 | J Med Chem. 2006 Oct 19;49(21):6391-9.Structure-activity relationship studies on a novel series of (S)-2beta-substituted 3alpha-[bis(4-fluoro- or 4-chlorophenyl)methoxy]tropane analogues for in vivo investigation. | ||||
Ref 528735 | J Med Chem. 2007 Apr 19;50(8):1925-32. Epub 2007 Mar 17.Designing active template molecules by combining computational de novo design and human chemist's expertise. | ||||
Ref 529178 | Bioorg Med Chem Lett. 2008 Jan 15;18(2):825-7. Epub 2007 Nov 17.Design and synthesis of a fluorescent muscarinic antagonist. | ||||
Ref 529789 | J Med Chem. 2008 Nov 27;51(22):7094-8.cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain responses against carrageenan-induced hyperalgesia. | ||||
Ref 529957 | J Med Chem. 1991 Oct;34(10):2984-9.Muscarinic receptor binding profile of para-substituted caramiphen analogues. | ||||
Ref 530266 | Bioorg Med Chem Lett. 2009 Aug 15;19(16):4560-2. Epub 2009 Jul 8.Discovery of (3-endo)-3-(2-cyano-2,2-diphenylethyl)-8,8-dimethyl-8-azoniabicyclo[3.2.1]octane bromide as an efficacious inhaled muscarinic acetylcholine receptor antagonist for the treatment of COPD. | ||||
Ref 530300 | J Med Chem. 2009 Sep 10;52(17):5307-10.Characterization of novel selective H1-antihistamines for clinical evaluation in the treatment of insomnia. | ||||
Ref 530313 | J Med Chem. 1990 Feb;33(2):809-14.Chloro-substituted, sterically hindered 5,11-dicarbo analogues of clozapine as potential chiral antipsychotic agents. | ||||
Ref 530541 | Enantiomers of oxybutynin: in vitro pharmacological characterization at M1, M2 and M3 muscarinic receptors and in vivo effects on urinary bladder contraction, mydriasis and salivary secretion in guinea pigs. J Pharmacol Exp Ther. 1991 Feb;256(2):562-7. | ||||
Ref 530866 | Effects of nebracetam (WEB 1881 FU), a novel nootropic, as a M1-muscarinic agonist. Jpn J Pharmacol. 1991 Jan;55(1):177-80. | ||||
Ref 531079 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
Ref 533165 | J Med Chem. 1989 Dec;32(12):2573-82.Synthesis and pharmacological evaluation of a series of 4-piperazinylpyrazolo[3,4-b]- and -[4,3-b][1,5]benzodiazepines as potential anxiolytics. | ||||
Ref 533345 | J Med Chem. 1989 May;32(5):1057-62.Synthesis and biological evaluation of [125I]- and [123I]-4-iododexetimide, a potent muscarinic cholinergic receptor antagonist. | ||||
Ref 533450 | J Med Chem. 1988 Jul;31(7):1312-6.Heterocyclic muscarinic agonists. Synthesis and biological activity of some bicyclic sulfonium arecoline bioisosteres. | ||||
Ref 533577 | J Med Chem. 1981 Sep;24(9):1021-6.Synthesis of clozapine analogues and their affinity for clozapine and spiroperidol binding sites in rat brain. | ||||
Ref 533879 | Effect of telenzepine, an M1-selective muscarinic receptor antagonist, in patients with nocturnal asthma. Pulm Pharmacol. 1994 Apr;7(2):91-7. | ||||
Ref 533965 | Influence of the cholinergic agonist SDZ 210-086 on sleep in healthy subjects. Neuropsychopharmacology. 1993 Nov;9(3):225-32. | ||||
Ref 534044 | J Med Chem. 1993 Apr 2;36(7):842-7.Design, synthesis, and neurochemical evaluation of 5-(3-alkyl-1,2,4- oxadiazol-5-yl)-1,4,5,6-tetrahydropyrimidines as M1 muscarinic receptor agonists. | ||||
Ref 534349 | J Med Chem. 1997 Mar 14;40(6):851-7.3'-Chloro-3 alpha-(diphenylmethoxy)tropane but not 4'-chloro-3 alpha-(diphenylmethoxy)tropane produces a cocaine-like behavioral profile. | ||||
Ref 534645 | J Med Chem. 1998 Jun 4;41(12):2047-55.6beta-Acetoxynortropane: a potent muscarinic agonist with apparent selectivity toward M2-receptors. | ||||
Ref 534674 | In vivo muscarinic cholinergic mediated effects of Lu 25-109, a M1 agonist and M2/M3 antagonist in vitro. Psychopharmacology (Berl). 1998 Jun;137(3):233-40. | ||||
Ref 534723 | J Med Chem. 1998 Oct 22;41(22):4181-5.Synthesis and modeling studies of a potent conformationally rigid muscarinic agonist: 1-azabicyclo[2.2.1]heptanespirofuranone. | ||||
Ref 534888 | Ultraviolet spectroscopic estimation of microenvironments and bitter tastes of oxyphenonium bromide in cyclodextrin solutions. J Pharm Sci. 1999 Aug;88(8):759-62. | ||||
Ref 535016 | Evaluation of in vivo binding properties of 3H-NMPB and 3H-QNB in mouse brain. J Neural Transm. 1999;106(7-8):583-92. | ||||
Ref 535511 | Memory-related task performance by aged rhesus monkeys administered the muscarinic M(1)-preferring agonist, talsaclidine. Psychopharmacology (Berl). 2002 Jul;162(3):292-300. Epub 2002 May 29. | ||||
Ref 535754 | A pharmacological profile of glycopyrrolate: interactions at the muscarinic acetylcholine receptor. Gen Pharmacol. 1992 Nov;23(6):1165-70. | ||||
Ref 535794 | The effect of muscarinic receptor blockers on non-specific bronchial reactivity in patients with bronchial asthma. Pneumonol Alergol Pol. 1992;60(11-12):32-6. | ||||
Ref 535833 | M1 muscarinic agonists can modulate some of the hallmarks in Alzheimer's disease: implications in future therapy. J Mol Neurosci. 2003;20(3):349-56. | ||||
Ref 536001 | Involvement of the peripheral cholinergic muscarinic system in the compensatory ovarian hypertrophy in the rat. Exp Biol Med (Maywood). 2004 Sep;229(8):793-805. | ||||
Ref 536453 | Muscarinic preferential M(1) receptor antagonists enhance the discriminative-stimulus effects of cocaine in rats. Pharmacol Biochem Behav. 2007 Oct;87(4):400-4. Epub 2007 Jun 2. | ||||
Ref 536471 | Autonomic cardiovascular control during a novel pharmacologic alternative to ganglionic blockade. Clin Pharmacol Ther. 2008 May;83(5):692-701. Epub 2007 Aug 8. | ||||
Ref 536601 | M1 muscarinic agonists target major hallmarks of Alzheimer's disease--an update. Curr Alzheimer Res. 2007 Dec;4(5):577-80. | ||||
Ref 536690 | Formulation and biopharmaceutical evaluation of transdermal patch containing benztropine. Int J Pharm. 2008 Jun 5;357(1-2):55-60. Epub 2008 Jan 20. | ||||
Ref 536802 | The role of M1 muscarinic cholinergic receptors in the discriminative stimulus properties of N-desmethylclozapine and the atypical antipsychotic drug clozapine in rats. Psychopharmacology (Berl). 2009 Apr;203(2):295-301. Epub 2008 Aug 7. | ||||
Ref 537030 | Pharmacological comparison of muscarinic ligands: historical versus more recent muscarinic M1-preferring receptor agonists. Eur J Pharmacol. 2009 Mar 1;605(1-3):53-6. Epub 2009 Jan 11. | ||||
Ref 537295 | Negative crosstalk between M1 and M2 muscarinic autoreceptors involves endogenous adenosine activating A1 receptors at the rat motor endplate. Neurosci Lett. 2009 Aug 14;459(3):127-31. Epub 2009 May7. | ||||
Ref 537482 | Fustin flavonoid attenuates beta-amyloid (1-42)-induced learning impairment. J Neurosci Res. 2009 Jun 16. | ||||
Ref 537630 | Characterization of undifferentiated muscarinic thyroid cells in Fisher rats.. Endocrinol Nutr. 2009 Mar;56(3):106-11. Epub 2009 May 18. | ||||
Ref 537692 | Capillary gas chromatography of trihexyphenidyl, procyclidine and cycrimine in biological fluids. J Chromatogr. 1989 Sep 29;494:135-42. | ||||
Ref 537849 | Evidence for prejunctional muscarinic autoreceptors in human and guinea pig trachea. Am J Respir Crit Care Med. 1995 Sep;152(3):872-8. | ||||
Ref 538104 | On the unique binding and activating properties of xanomeline at the M1 muscarinic acetylcholine receptor. Mol Pharmacol. 1998 Jun;53(6):1120-30. | ||||
Ref 540839 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5436). | ||||
Ref 544266 | Evaluation of an Innovative Population Pharmacokinetic-Based Design for Behavioral Pharmacodynamic Endpoints. AAPS J. 2012 December; 14(4): 657-663. | ||||
Ref 550343 | Phase I clinical trial of muscarinic agonist (AC-262271) for treating glaucoma. Acadia Pharmaceuticals. | ||||
Ref 551234 | A novel and selective class of azabicyclic muscarinic agonists incorporating an N-methoxy imidoyl halide or nitrile functionality, Bioorg. Med. Chem. Lett. 2(8):791-796 (1992). | ||||
Ref 551235 | Cholinergic agents: aldehyde, ketone, and oxime analogues of the muscarinic agonist UH5, Bioorg. Med. Chem. Lett. 2(8):803-808 (1992). | ||||
Ref 551341 | Design of dual acting anticonvulsant-antimuscarinic succinimide and hydantoin derivatives, Bioorg. Med. Chem. Lett. 7(8):979-984 (1997). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.