Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T79155
|
||||
| Former ID |
TTDR00457
|
||||
| Target Name |
Kallikrein 7
|
||||
| Gene Name |
KLK7
|
||||
| Synonyms |
HSCCE; Stratum corneum chymotryptic enzyme; KLK7
|
||||
| Target Type |
Research
|
||||
| Function |
May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. Cleaves insulin Achain at '14-Tyr-|-Gln-15' and insulin B chain at '6- Leu-|-Cys-7', '16-Tyr-|-Leu-17', '25-Phe-|-Tyr-26' and '26-Tyr-|- Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines.
|
||||
| BioChemical Class |
Peptidase
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.4.21.117
|
||||
| Sequence |
MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLV
NERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNS QARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVY KDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCK FTKWINDTMKKHR |
||||
| Pathways | |||||
| Reactome | Degradation of the extracellular matrix | ||||
| WikiPathways | Cytodifferentiation (Part 3 of 3) | ||||
| References | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.