Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T13201
|
||||
| Former ID |
TTDR01224
|
||||
| Target Name |
Carbonic anhydrase I
|
||||
| Gene Name |
CA1
|
||||
| Synonyms |
CA-I; Carbonate dehydratase I; Carbonic anhydrase B; CA1
|
||||
| Target Type |
Successful
|
||||
| Disease | Arthritis [ICD9: 710-719; ICD10: M00-M25] | ||||
| Breast cancer [ICD9: 174, 175; ICD10: C50] | |||||
| Chronic glaucoma [ICD9: 365; ICD10: H40-H42] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Glaucoma; Duodenal ulcers [ICD9: 365, 531-534; ICD10: H40-H42, K25-K27] | |||||
| Glaucoma [ICD9: 365; ICD10: H40-H42] | |||||
| Function |
Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.
|
||||
| BioChemical Class |
Carbon-oxygen lyases
|
||||
| Target Validation |
T13201
|
||||
| UniProt ID | |||||
| EC Number |
EC 4.2.1.1
|
||||
| Sequence |
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV PMQHNNRPTQPLKGRTVRASF |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Acetazolamide | Drug Info | Approved | Glaucoma | [538171], [541873] |
| Dichlorphenamide | Drug Info | Approved | Chronic glaucoma | [538446], [541889] | |
| Ethoxzolamide | Drug Info | Approved | Glaucoma; Duodenal ulcers | [538442], [541896] | |
| Methazolamide | Drug Info | Approved | Glaucoma | [525219], [541909] | |
| SALICYLATE | Drug Info | Phase 4 | Discovery agent | [524105] | |
| CG-100649 | Drug Info | Phase 3 | Arthritis | [524183], [543067] | |
| Curcumin | Drug Info | Phase 3 | Cancer | [532348], [542031] | |
| PARABEN | Drug Info | Phase 3 | Discovery agent | [524059] | |
| PHENOL | Drug Info | Phase 2/3 | Discovery agent | [525296] | |
| COUMATE | Drug Info | Phase 2 | Breast cancer | [531371] | |
| SULFAMIDE | Drug Info | Phase 1 | Discovery agent | [524873] | |
| Inhibitor | (2-bromophenyl)difluoromethanesulfonamide | Drug Info | [527782] | ||
| (4-bromophenyl)difluoromethanesulfonamide | Drug Info | [527782] | |||
| 1,4-Dihydro-1-methyl-4-oxo-3-pyridinesulfonamide | Drug Info | [530978] | |||
| 1-acetamido-5-sulfonamidoindane | Drug Info | [527262] | |||
| 1-Benzyl-1,4-dihydro-4-oxo-3-pyridinesulfonamide | Drug Info | [530978] | |||
| 1-cyclohexylamido-5-sulfonamidoindane | Drug Info | [528160] | |||
| 1-pentafluorophenylamido-5-sulfonamidoindane | Drug Info | [528160] | |||
| 1-valproylamido-5-sulfonamidoindane | Drug Info | [528160] | |||
| 2,2,2-Trifluoro-N-(4-sulfamoyl-phenyl)-acetamide | Drug Info | [527743] | |||
| 2,3-dihydro-1H-indene-5-sulfonamide | Drug Info | [527262] | |||
| 2,4-dichloro-5-sulfamoylbenzoic acid | Drug Info | [530578] | |||
| 2,4-Disulfamyltrifluoromethylaniline | Drug Info | [537461] | |||
| 2-(4-chlorobenzyloxyamino)-N-hydroxyacetamide | Drug Info | [528653] | |||
| 2-(4-chlorobenzyloxyamino)-N-hydroxyhexanamide | Drug Info | [528653] | |||
| 2-(4-chlorobenzyloxyamino)-N-hydroxypropanamide | Drug Info | [528653] | |||
| 2-(biphenyl-4-yl)vinylboronic acid | Drug Info | [530086] | |||
| 2-acetamido-5-sulfonamidoindane | Drug Info | [528160] | |||
| 2-Acetylamino-indan-5-sulfonic acid hydrate | Drug Info | [527262] | |||
| 2-Amino-indan-5-sulfonic acid | Drug Info | [527262] | |||
| 2-butylamido-5-sulfonamidoindane | Drug Info | [528160] | |||
| 2-cyclohexylamido-5-sulfonamidoindane | Drug Info | [528160] | |||
| 2-ethylamido-5-sulfonamidoindane | Drug Info | [528160] | |||
| 2-Hydroxycinnamic acid | Drug Info | [531068] | |||
| 2-Mercapto-N-(4-sulfamoyl-phenyl)-benzamide | Drug Info | [529381] | |||
| 2-Morpholin-4-yl-N-(4-sulfamoyl-phenyl)-acetamide | Drug Info | [527338] | |||
| 2-nonylamido-5-sulfonamidoindane | Drug Info | [528160] | |||
| 2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [530514] | |||
| 2-oxo-2H-thiochromene-3-carboxylic acid | Drug Info | [530514] | |||
| 2-pentafluorophenylamido-5-sulfonamidoindane | Drug Info | [528160] | |||
| 2-propylamido-5-sulfonamidoindane | Drug Info | [528160] | |||
| 2-valproylamido-5-sulfonamidoindane | Drug Info | [528160] | |||
| 3-(3-Phenyl-ureido)-benzenesulfonamide | Drug Info | [527743] | |||
| 3-(4-sulfamoylphenyl)propanoic acid | Drug Info | [537461] | |||
| 3-bromophenyl-difluoromethanesulfonamide | Drug Info | [527782] | |||
| 3-Chloro-4-hydrazino-benzenesulfonamide | Drug Info | [527482] | |||
| 3-Fluoro-4-hydrazino-benzenesulfonamide | Drug Info | [527482] | |||
| 3-mercapto-N-(4-sulfamoyl-phenyl)-propionamide | Drug Info | [528406] | |||
| 3-phenyl-5-sulfamoyl-1H-indole-2-carboxamide | Drug Info | [530132] | |||
| 3-phenylprop-1-enylboronic acid | Drug Info | [530086] | |||
| 3-[4-(AMINOSULFONYL)PHENYL]PROPANOIC ACID | Drug Info | [551374] | |||
| 4,4'-thiodipyridine-3-sulfonamide | Drug Info | [530766] | |||
| 4,6-Dinitro salicylic acid | Drug Info | [529721] | |||
| 4-(2-Amino-ethyl)-benzenesulfonamide | Drug Info | [527645] | |||
| 4-(2-aminopyrimidin-4-ylamino)benzenesulfonamide | Drug Info | [537461] | |||
| 4-(2-Methyl-8-quinolinoxy)-3-pyridinesulfonamide | Drug Info | [530766] | |||
| 4-(2-Phenylacetamido)-3-bromobenzenesulfonamide | Drug Info | [530219] | |||
| 4-(2-Phenylacetamido)-3-chlorobenzenesulfonamide | Drug Info | [530219] | |||
| 4-(2-Phenylacetamido)-3-fluorobenzenesulfonamide | Drug Info | [530219] | |||
| 4-(2-Phenylacetamido)benzenesulfonamide | Drug Info | [530219] | |||
| 4-(2-Phenylacetamidoethyl)benzenesulfonamide | Drug Info | [530219] | |||
| 4-(2-Phenylacetamidomethyl)benzenesulfonamide | Drug Info | [530219] | |||
| 4-(2-Propynylthio)pyridine-3-sulfonamide | Drug Info | [530766] | |||
| 4-(2-Pyridin-2-ylacetamido)benzenesulfonamide | Drug Info | [530219] | |||
| 4-(2-Pyridin-4-ylacetamido)benzenesulfonamide | Drug Info | [530219] | |||
| 4-(4-Cyanophenoxy)-3-pyridinesulfonamide | Drug Info | [530766] | |||
| 4-(4-Fluorophenoxy)-3-pyridinesulfonamide | Drug Info | [530766] | |||
| 4-(5-Methyl-2-pirazolino)-3-pyridinesulfonamide | Drug Info | [530766] | |||
| 4-(Allylamino)-3-pyridinesulfonamide | Drug Info | [530766] | |||
| 4-(Carbamolymethylthio)pyridine-3-sulfonamide | Drug Info | [530766] | |||
| 4-(Cyanomethylthio)pyridine-3-sulfonamide | Drug Info | [530766] | |||
| 4-(hydroxymethyl)benzenesulfonamide | Drug Info | [537461] | |||
| 4-(Methylhydrazino)-3-pyridinesulfonamide | Drug Info | [530766] | |||
| 4-(N-Oxide-2-pyridylthio)pyridine-3-sulfonamide | Drug Info | [530766] | |||
| 4-(Quinolinoxy)-3-pyridinesulfonamide | Drug Info | [530766] | |||
| 4-Amino-3-bromo-benzenesulfonamide | Drug Info | [537461] | |||
| 4-Amino-3-chloro-benzenesulfonamide | Drug Info | [537461] | |||
| 4-Amino-3-fluoro-benzenesulfonamide | Drug Info | [531031] | |||
| 4-Amino-3-iodo-benzenesulfonamide | Drug Info | [537461] | |||
| 4-amino-6-chlorobenzene-1,3-disulfonamide | Drug Info | [531031] | |||
| 4-amino-N-(4-sulfamoylbenzyl)benzenesulfonamide | Drug Info | [537461] | |||
| 4-azidobenzenesulfonamide | Drug Info | [529609] | |||
| 4-Benzenesulfonylamino-benzenesulfonamide | Drug Info | [527743] | |||
| 4-Benzythiopyridine-3-sulfonamide | Drug Info | [530766] | |||
| 4-bromophenylboronic acid | Drug Info | [530086] | |||
| 4-butylphenylboronic acid | Drug Info | [530086] | |||
| 4-Chloro-N-(5-sulfamoyl-indan-2-yl)-benzamide | Drug Info | [527262] | |||
| 4-Ethoxy-3-pyridinesulfonamide | Drug Info | [530766] | |||
| 4-ethynyl benzene sulfonamide | Drug Info | [529344] | |||
| 4-fluoro-N-(4-sulfamoylbenzyl)benzenesulfonamide | Drug Info | [529884] | |||
| 4-Hydrazino-3-pyridinesulfonamide | Drug Info | [530766] | |||
| 4-Hydrazino-benzenesulfonamide | Drug Info | [527482] | |||
| 4-Hydrazinocarbonyl-benzenesulfonamide | Drug Info | [527482] | |||
| 4-isothiocyanatobenzenesulfonamide | Drug Info | [527233] | |||
| 4-Methanesulfonylamino-benzenesulfonamide | Drug Info | [527743] | |||
| 4-Methoxy-3-pyridinesulfonamide | Drug Info | [530766] | |||
| 4-methoxyphenylboronic acid | Drug Info | [530086] | |||
| 4-methylphenyl-difluoromethanesulfonamide | Drug Info | [527782] | |||
| 4-methylstyrylboronic acid | Drug Info | [530086] | |||
| 4-Methylthiopyridine-3-sulfonamide | Drug Info | [530766] | |||
| 4-nitrophenyl phosphate | Drug Info | [531156] | |||
| 4-nitrophenyl-difluoromethanesulfonamide | Drug Info | [527782] | |||
| 4-phenoxyphenylboronic acid | Drug Info | [530086] | |||
| 4-[2-(2-Thienyl)acetamidoethyl]benzenesulfonamide | Drug Info | [530219] | |||
| 4-[2-(2-Thienyl)acetamido]benzenesulfonamide | Drug Info | [530219] | |||
| 4-[2-(3-Phenyl-ureido)-ethyl]-benzenesulfonamide | Drug Info | [527743] | |||
| 5-amino-1,3,4-thiadiazole-2-sulfonamide | Drug Info | [531112] | |||
| 5-Amino-[1,3,4]thiadiazole-2-thiol | Drug Info | [527519] | |||
| 5-Chlorosalicylic Acid | Drug Info | [529721] | |||
| 5-hydroxy-1-tosyl-1H-pyrrol-2(5H)-one | Drug Info | [530979] | |||
| 5-oxo-1-tosyl-2,5-dihydro-1Hpyrrol-2-yl acetate | Drug Info | [530979] | |||
| 6-(aminomethyl)-2H-chromen-2-one | Drug Info | [530514] | |||
| 6-Amino-benzothiazole-2-sulfonic acid amide | Drug Info | [525539] | |||
| 6-Hydroxy-benzothiazole-2-sulfonic acid amide | Drug Info | [529948] | |||
| 6-methoxy-2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [530514] | |||
| 6-methyl-2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [530514] | |||
| 7-methoxy-2-oxo-2H-chromene-4-carboxylic acid | Drug Info | [530514] | |||
| 8-methoxy-2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [530514] | |||
| Aminobenzolamide derivative | Drug Info | [527261] | |||
| Azide | Drug Info | [527260] | |||
| BENZENESULFONAMIDE | Drug Info | [530046] | |||
| BENZOLAMIDE | Drug Info | [537461] | |||
| Benzothiazole-2-sulfonic acid amide | Drug Info | [527408] | |||
| Beta-naphthylboronic acid | Drug Info | [530086] | |||
| Biphenyl-4-ylboronic acid | Drug Info | [530086] | |||
| Carbamoyl phosphate disodium | Drug Info | [527259] | |||
| Carzenide | Drug Info | [530046] | |||
| CATECHIN | Drug Info | [531068] | |||
| CG-100649 | Drug Info | [533275] | |||
| CL-5343 | Drug Info | [543654] | |||
| COUMARIN | Drug Info | [531259] | |||
| COUMATE | Drug Info | [529605] | |||
| Curcumin | Drug Info | [531068] | |||
| CYANATE | Drug Info | [527260] | |||
| Cynooxide anion | Drug Info | [527211] | |||
| Decane-1,10-diyl disulfamate | Drug Info | [530359] | |||
| Decyl sulfamate | Drug Info | [530359] | |||
| ELLAGIC ACID | Drug Info | [530751] | |||
| ETHYL 3-[4-(AMINOSULFONYL)PHENYL]PROPANOATE | Drug Info | [551374] | |||
| FERULIC ACID | Drug Info | [530751] | |||
| GALLICACID | Drug Info | [530751] | |||
| HERNIARIN | Drug Info | [530514] | |||
| Hexane-1,6-diamine | Drug Info | [530998] | |||
| HYDROSULFIDE | Drug Info | [527260] | |||
| IODIDE | Drug Info | [527231] | |||
| N-(4-cyanophenyl)sulfamide | Drug Info | [527520] | |||
| N-(4-Sulfamoyl-phenyl)-benzamide | Drug Info | [527743] | |||
| N-(4-Sulfamoyl-phenyl)-butyramide | Drug Info | [527743] | |||
| N-(4-Sulfamoyl-phenyl)-propionamide | Drug Info | [527743] | |||
| N-(4-sulfamoylphenylethyl)-4-sulfamoylbenzamide | Drug Info | [551223] | |||
| N-(5-ethyl-1,3,4-thiadiazol-2-yl)sulfamide | Drug Info | [529794] | |||
| N-(5-Mercapto-[1,3,4]thiadiazol-2-yl)-acetamide | Drug Info | [527519] | |||
| N-(5-phenyl-1,3,4-thiadiazol-2-yl)sulfamide | Drug Info | [529794] | |||
| N-(5-tert-butyl-1,3,4-thiadiazol-2-yl)sulfamide | Drug Info | [529794] | |||
| N-(pentafluorophenyl)sulfamide | Drug Info | [527520] | |||
| N-1,3,4-thiadiazol-2-ylsulfamide | Drug Info | [529794] | |||
| N-hydroxysulfamide | Drug Info | [530922] | |||
| N-hydroxysulfonamides | Drug Info | [538135] | |||
| N-propynyl amidebenzenesulphonide | Drug Info | [528491] | |||
| N-unsubstituted carbamate esters | Drug Info | [535861] | |||
| N-[4-(trifluoromethyl)phenyl]sulfamide | Drug Info | [527520] | |||
| N-[5-(ethylthio)-1,3,4-thiadiazol-2-yl]sulfamide | Drug Info | [529794] | |||
| N-[5-(methylthio)-1,3,4-thiadiazol-2-yl]sulfamide | Drug Info | [529794] | |||
| N-{2-[4-(AMINOSULFONYL)PHENYL]ETHYL}ACETAMIDE | Drug Info | [551374] | |||
| NITRATE | Drug Info | [527231] | |||
| NSC-654077 | Drug Info | [529381] | |||
| Octane-1,8-diyl disulfamate | Drug Info | [530359] | |||
| Octyl sulfamate | Drug Info | [530359] | |||
| P-Coumaric Acid | Drug Info | [530751] | |||
| PARABEN | Drug Info | [530751] | |||
| PARAOXON | Drug Info | [531156] | |||
| Pentane-1,5-diamine | Drug Info | [530998] | |||
| Pentanoic acid (4-sulfamoyl-phenyl)-amide | Drug Info | [527743] | |||
| Phenethylboronic acid | Drug Info | [530086] | |||
| PHENOL | Drug Info | [531068] | |||
| Phenoxyarsonous acid | Drug Info | [527231] | |||
| Phenyl Boronic acid | Drug Info | [527231] | |||
| PHENYLDIFLUOROMETHANESULFONAMIDE | Drug Info | [527782] | |||
| PHENYLMETHANESULFONAMIDE | Drug Info | [527782] | |||
| PHENYLSULFAMATE | Drug Info | [527782] | |||
| Prop-2-ynyl 4-sulfamoylbenzoate | Drug Info | [528491] | |||
| SACCHARIN | Drug Info | [531031] | |||
| SALICYLATE | Drug Info | [529562] | |||
| Sodium trithiocarbonate | Drug Info | [530003] | |||
| Styrylboronic acid | Drug Info | [530086] | |||
| SULFAMATE | Drug Info | [527231] | |||
| Sulfamic acid 12-sulfamoyloxy-dodecyl ester | Drug Info | [527391] | |||
| Sulfamic acid 16-sulfamoyloxy-hexadecyl ester | Drug Info | [527391] | |||
| Sulfamic acid 3-sulfamoyloxy-phenyl ester | Drug Info | [527391] | |||
| Sulfamic acid 4-sulfamoyloxy-butyl ester | Drug Info | [527391] | |||
| Sulfamic acid 6-sulfamoyloxy-hexyl ester | Drug Info | [527391] | |||
| Sulfamic acid 7-sulfamoyloxy-heptyl ester | Drug Info | [527391] | |||
| SULFAMIDE | Drug Info | [527231] | |||
| Sulfanilamide derivative | Drug Info | [527560] | |||
| SULFATE | Drug Info | [527231] | |||
| Sulfenamido-sulfonamides | Drug Info | [538055] | |||
| Syringic Acid | Drug Info | [530751] | |||
| Thioureido sulfonamide | Drug Info | [527655] | |||
| [Au(CN)2]- | Drug Info | [527492] | |||
| [Cu(CN)2]- | Drug Info | [527492] | |||
| Modulator | Acetazolamide | Drug Info | [556264] | ||
| Dichlorphenamide | Drug Info | [556264] | |||
| Ethoxzolamide | Drug Info | [556264] | |||
| L-693612 | Drug Info | [531635], [533846] | |||
| Methazolamide | Drug Info | [543654] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Nitrogen metabolism | ||||
| Pathway Interaction Database | C-MYB transcription factor network | ||||
| PathWhiz Pathway | Gastric Acid Production | ||||
| Reactome | Erythrocytes take up carbon dioxide and release oxygen | ||||
| Erythrocytes take up oxygen and release carbon dioxide | |||||
| Reversible hydration of carbon dioxide | |||||
| WikiPathways | Reversible Hydration of Carbon Dioxide | ||||
| Uptake of Carbon Dioxide and Release of Oxygen by Erythrocytes | |||||
| Uptake of Oxygen and Release of Carbon Dioxide by Erythrocytes | |||||
| References | |||||
| Ref 524059 | ClinicalTrials.gov (NCT01688479) Trial Comparing Calendula Officinalis With Aqueous Cream "Essex" to Treat Skin Reactions From Radiotherapy of Breast Cancer. U.S. National Institutes of Health. | ||||
| Ref 524105 | ClinicalTrials.gov (NCT01712295) 17% Salicylate Versus 17% Salicylate-Ethyl Pyruvate for Plantar Foot Warts. U.S. National Institutes of Health. | ||||
| Ref 524183 | ClinicalTrials.gov (NCT01765296) Phase III Study of CG100649 in Osteoarthritis Patients. U.S. National Institutes of Health. | ||||
| Ref 524873 | ClinicalTrials.gov (NCT02216669) Trial to Determine Optimal Phase II Dose of the Oral Dual CAIX Inhibitor/ Radiosensitizer. U.S. National Institutes of Health. | ||||
| Ref 525219 | ClinicalTrials.gov (NCT02463357) Three New Ideas to Protect Special Forces From the Stress of High Altitude. | ||||
| Ref 525296 | ClinicalTrials.gov (NCT02527187) Determination of the Sensitivity and Specificity of Prick Test Betula Verrucosa. | ||||
| Ref 531371 | Irosustat: a first-generation steroid sulfatase inhibitor in breast cancer. Expert Rev Anticancer Ther. 2011 Feb;11(2):179-83. | ||||
| Ref 532348 | Nanocurcumin: a promising therapeutic advancement over native curcumin. Crit Rev Ther Drug Carrier Syst. 2013;30(4):331-68. | ||||
| Ref 538171 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 040195. | ||||
| Ref 538442 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011047. | ||||
| Ref 538446 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011366. | ||||
| Ref 541873 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6792). | ||||
| Ref 541889 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6807). | ||||
| Ref 541896 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6814). | ||||
| Ref 541909 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6828). | ||||
| Ref 525539 | J Med Chem. 1999 Jul 15;42(14):2641-50.Carbonic anhydrase inhibitors. Synthesis of water-soluble, topically effective, intraocular pressure-lowering aromatic/heterocyclic sulfonamides containing cationic or anionic moieties: is the tail more important than the ring?. | ||||
| Ref 527211 | Bioorg Med Chem Lett. 2004 Sep 6;14(17):4563-7.Carbonic anhydrase inhibitors. Inhibition of the beta-class enzyme from the methanoarchaeon Methanobacterium thermoautotrophicum (Cab) with anions. | ||||
| Ref 527231 | Bioorg Med Chem Lett. 2004 Nov 1;14(21):5435-9.Carbonic anhydrase inhibitors. Inhibition of the newly isolated murine isozyme XIII with anions. | ||||
| Ref 527233 | J Med Chem. 2004 Oct 7;47(21):5224-9.Carbonic anhydrase inhibitors: the first on-resin screening of a 4-sulfamoylphenylthiourea library. | ||||
| Ref 527259 | Bioorg Med Chem Lett. 2004 Dec 6;14(23):5763-7.Carbonic anhydrase inhibitors. Interaction of isozymes I, II, IV, V, and IX with phosphates, carbamoyl phosphate, and the phosphonate antiviral drug foscarnet. | ||||
| Ref 527260 | Bioorg Med Chem Lett. 2004 Dec 6;14(23):5769-73.Carbonic anhydrase inhibitors: inhibition of the membrane-bound human isozyme IV with anions. | ||||
| Ref 527261 | Bioorg Med Chem Lett. 2004 Dec 6;14(23):5775-80.Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, and IX with sulfonamides derived from 4-isothiocyanato-benzolamide. | ||||
| Ref 527262 | Bioorg Med Chem Lett. 2004 Dec 6;14(23):5781-6.Carbonic anhydrase inhibitors. Design of anticonvulsant sulfonamides incorporating indane moieties. | ||||
| Ref 527338 | Bioorg Med Chem Lett. 2005 Jan 17;15(2):367-72.Carbonic anhydrase inhibitors. Novel sulfanilamide/acetazolamide derivatives obtained by the tail approach and their interaction with the cytosolic isozymes I and II, and the tumor-associated isozyme IX. | ||||
| Ref 527391 | Bioorg Med Chem Lett. 2005 Feb 1;15(3):579-84.Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, and IX with bis-sulfamates. | ||||
| Ref 527408 | Bioorg Med Chem Lett. 2005 Feb 15;15(4):971-6.Carbonic anhydrase inhibitors. Inhibition of the human cytosolic isozyme VII with aromatic and heterocyclic sulfonamides. | ||||
| Ref 527482 | J Med Chem. 2005 Mar 24;48(6):2121-5.Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/membrane-associated carbonic anhydrase isozymes I, II, and IX with sulfonamides incorporatinghydrazino moieties. | ||||
| Ref 527492 | Bioorg Med Chem Lett. 2005 Apr 1;15(7):1909-13.Carbonic anhydrase inhibitors. Inhibition of isozymes I, II, IV, V and IX with complex fluorides, chlorides and cyanides. | ||||
| Ref 527519 | Bioorg Med Chem Lett. 2005 May 2;15(9):2347-52.Carbonic anhydrase inhibitors. Inhibition of the cytosolic and tumor-associated carbonic anhydrase isozymes I, II, and IX with a series of 1,3,4-thiadiazole- and 1,2,4-triazole-thiols. | ||||
| Ref 527520 | Bioorg Med Chem Lett. 2005 May 2;15(9):2353-8.Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, IX, and XII with N-hydroxysulfamides--a new zinc-binding function in the design of inhibitors. | ||||
| Ref 527560 | Bioorg Med Chem Lett. 2005 Jun 15;15(12):3096-101.Carbonic anhydrase inhibitors. Inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, IX, and XII with Schiff's bases incorporating chromone and aromatic sulfonamide moieties, and their zinc complexes. | ||||
| Ref 527645 | J Med Chem. 2005 Jul 28;48(15):4834-41.Carbonic anhydrase inhibitors. Design of fluorescent sulfonamides as probes of tumor-associated carbonic anhydrase IX that inhibit isozyme IX-mediated acidification of hypoxic tumors. | ||||
| Ref 527655 | Bioorg Med Chem Lett. 2005 Sep 1;15(17):3821-7.Carbonic anhydrase inhibitors: design of thioureido sulfonamides with potent isozyme II and XII inhibitory properties and intraocular pressure lowering activity in a rabbit model of glaucoma. | ||||
| Ref 527743 | Bioorg Med Chem Lett. 2005 Nov 1;15(21):4862-6.Carbonic anhydrase inhibitors: inhibition of the tumor-associated isozymes IX and XII with a library of aromatic and heteroaromatic sulfonamides. | ||||
| Ref 527782 | Bioorg Med Chem Lett. 2005 Dec 1;15(23):5192-6. Epub 2005 Oct 3.Carbonic anhydrase inhibitors: inhibition of the human isozymes I, II, VA, and IX with a library of substituted difluoromethanesulfonamides. | ||||
| Ref 528160 | J Med Chem. 2006 May 4;49(9):2743-9.Indanesulfonamides as carbonic anhydrase inhibitors. Toward structure-based design of selective inhibitors of the tumor-associated isozyme CA IX. | ||||
| Ref 528406 | J Med Chem. 2006 Sep 7;49(18):5544-51.Carbonic anhydrase inhibitors: Hypoxia-activatable sulfonamides incorporating disulfide bonds that target the tumor-associated isoform IX. | ||||
| Ref 528491 | J Med Chem. 2006 Nov 2;49(22):6539-48.A novel class of carbonic anhydrase inhibitors: glycoconjugate benzene sulfonamides prepared by "click-tailing". | ||||
| Ref 528653 | Bioorg Med Chem. 2007 Mar 15;15(6):2298-311. Epub 2007 Jan 19.Carbonic anhydrase and matrix metalloproteinase inhibitors. Inhibition of human tumor-associated isozymes IX and cytosolic isozyme I andII with sulfonylated hydroxamates. | ||||
| Ref 529344 | J Med Chem. 2008 Mar 27;51(6):1945-53. Epub 2008 Feb 29.Inhibition of carbonic anhydrases with glycosyltriazole benzene sulfonamides. | ||||
| Ref 529381 | J Med Chem. 2008 Jun 12;51(11):3051-6. Epub 2008 Mar 19.Recent developments of carbonic anhydrase inhibitors as potential anticancer drugs. | ||||
| Ref 529562 | Bioorg Med Chem. 2008 Aug 1;16(15):7424-8. Epub 2008 Jun 13.Carbonic anhydrase inhibitors: inhibition of mammalian isoforms I-XIV with a series of substituted phenols including paracetamol and salicylic acid. | ||||
| Ref 529605 | Bioorg Med Chem Lett. 2008 Aug 1;18(15):4282-6. Epub 2008 Jul 5.Carbonic anhydrase inhibitors. Interaction of the antitumor sulfamate EMD 486019 with twelve mammalian carbonic anhydrase isoforms: Kinetic and X-ray crystallographic studies. | ||||
| Ref 529609 | Bioorg Med Chem Lett. 2008 Aug 15;18(16):4624-7. Epub 2008 Jul 10.Inhibition of human mitochondrial carbonic anhydrases VA and VB with para-(4-phenyltriazole-1-yl)-benzenesulfonamide derivatives. | ||||
| Ref 529721 | Bioorg Med Chem. 2008 Oct 15;16(20):9101-5. Epub 2008 Sep 13.In vitro inhibition of salicylic acid derivatives on human cytosolic carbonic anhydrase isozymes I and II. | ||||
| Ref 529794 | Bioorg Med Chem Lett. 2008 Dec 15;18(24):6332-5. Epub 2008 Nov 1.Carbonic anhydrase inhibitors: 2-substituted-1,3,4-thiadiazole-5-sulfamides act as powerful and selective inhibitors of the mitochondrial isozymes VA and VB over the cytosolic and membrane-associated carbonic anhydrases I, II and IV. | ||||
| Ref 529884 | Bioorg Med Chem. 2009 Jan 15;17(2):553-7. Epub 2008 Dec 6.Ligand-based and structure-based virtual screening to identify carbonic anhydrase IX inhibitors. | ||||
| Ref 529948 | J Med Chem. 2009 Feb 12;52(3):646-54.Cloning, expression, post-translational modifications and inhibition studies on the latest mammalian carbonic anhydrase isoform, CA XV. | ||||
| Ref 530003 | Bioorg Med Chem Lett. 2009 Apr 1;19(7):1855-7. Epub 2009 Feb 26.Carbonic anhydrase inhibitors. Inhibition of cytosolic isoforms I, II, III, VII and XIII with less investigated inorganic anions. | ||||
| Ref 530046 | Nat Chem Biol. 2009 May;5(5):341-3. Epub 2009 Mar 29.Ligand-directed tosyl chemistry for protein labeling in vivo. | ||||
| Ref 530086 | Bioorg Med Chem Lett. 2009 May 15;19(10):2642-5. Epub 2009 Apr 5.Carbonic anhydrase inhibitors. Inhibition of the fungal beta-carbonic anhydrases from Candida albicans and Cryptococcus neoformans with boronic acids. | ||||
| Ref 530132 | J Med Chem. 2009 Jul 9;52(13):4063-7.Discovery of low nanomolar and subnanomolar inhibitors of the mycobacterial beta-carbonic anhydrases Rv1284 and Rv3273. | ||||
| Ref 530219 | Bioorg Med Chem. 2009 Jul 15;17(14):4894-9. Epub 2009 Jun 9.Carbonic anhydrase inhibitors. Aromatic/heterocyclic sulfonamides incorporating phenacetyl, pyridylacetyl and thienylacetyl tails act as potent inhibitors of human mitochondrial isoforms VA and VB. | ||||
| Ref 530359 | J Med Chem. 2009 Oct 8;52(19):5990-8.Carbonic anhydrase inhibitors. Comparison of aliphatic sulfamate/bis-sulfamate adducts with isozymes II and IX as a platform for designing tight-binding, more isoform-selective inhibitors. | ||||
| Ref 530514 | J Med Chem. 2010 Jan 14;53(1):335-44.Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins. | ||||
| Ref 530578 | Bioorg Med Chem. 2010 Jan 15;18(2):930-8. Epub 2009 Nov 20.Synthesis, characterization and antiglaucoma activity of a novel proton transfer compound and a mixed-ligand Zn(II) complex. | ||||
| Ref 530751 | Bioorg Med Chem. 2010 Mar 15;18(6):2159-64. Epub 2010 Feb 6.Carbonic anhydrase inhibitors. Inhibition of mammalian isoforms I-XIV with a series of natural product polyphenols and phenolic acids. | ||||
| Ref 530766 | Eur J Med Chem. 2010 Jun;45(6):2396-404. Epub 2010 Feb 12.Carbonic anhydrase inhibitors: synthesis and inhibition of the human cytosolic isozymes I and II and transmembrane isozymes IX, XII (cancer-associated) and XIV with 4-substituted 3-pyridinesulfonamides. | ||||
| Ref 530922 | Bioorg Med Chem Lett. 2010 Jun 15;20(12):3601-5. Epub 2010 Apr 28.Carbonic anhydrase inhibitors: crystallographic and solution binding studies for the interaction of a boron-containing aromatic sulfamide with mammalian isoforms I-XV. | ||||
| Ref 530978 | Eur J Med Chem. 2010 Sep;45(9):3656-61. Epub 2010 May 12.Carbonic anhydrase inhibitors. Regioselective synthesis of novel 1-substituted 1,4-dihydro-4-oxo-3-pyridinesulfonamides and their inhibition of the human cytosolic isozymes I and II and transmembrane cancer-associated isozymes IX and XII. | ||||
| Ref 530979 | Bioorg Med Chem. 2010 Jun 15;18(12):4468-74. Epub 2010 May 28.A novel and one-pot synthesis of new 1-tosyl pyrrol-2-one derivatives and analysis of carbonic anhydrase inhibitory potencies. | ||||
| Ref 530998 | J Med Chem. 2010 Aug 12;53(15):5511-22.Polyamines inhibit carbonic anhydrases by anchoring to the zinc-coordinated water molecule. | ||||
| Ref 531031 | Bioorg Med Chem. 2010 Aug 1;18(15):5498-503. Epub 2010 Jun 22.Mutation of Phe91 to Asn in human carbonic anhydrase I unexpectedly enhanced both catalytic activity and affinity for sulfonamide inhibitors. | ||||
| Ref 531068 | Bioorg Med Chem Lett. 2010 Sep 1;20(17):5050-3. Epub 2010 Jul 13.Carbonic anhydrase inhibitors. Antioxidant polyphenols effectively inhibit mammalian isoforms I-XV. | ||||
| Ref 531112 | Eur J Med Chem. 2010 Nov;45(11):4769-73. Epub 2010 Jul 24.Synthesis, characterization and antiglaucoma activity of some novel pyrazole derivatives of 5-amino-1,3,4-thiadiazole-2-sulfonamide. | ||||
| Ref 531156 | Bioorg Med Chem Lett. 2010 Nov 1;20(21):6208-12. Epub 2010 Aug 26.Paraoxon, 4-nitrophenyl phosphate and acetate are substrates of |A- but not of |A-, |?- and |?-carbonic anhydrases. | ||||
| Ref 531259 | Bioorg Med Chem Lett. 2010 Dec 15;20(24):7255-8. Epub 2010 Oct 25.7,8-disubstituted- but not 6,7-disubstituted coumarins selectively inhibit the transmembrane, tumor-associated carbonic anhydrase isoforms IX and XII over the cytosolic ones I and II in the low nanomolar/subnanomolar range. | ||||
| Ref 531635 | Therapeutic target database update 2012: a resource for facilitating target-oriented drug discovery. Nucleic Acids Res. 2012 Jan;40(Database issue):D1128-36. | ||||
| Ref 533275 | Understanding the Dual Inhibition of COX-2 and Carbonic Anhydrase-II by Celecoxib and CG100649 Using Density Functional Theory Calculations and other Molecular Modelling Approaches. Protein Pept Lett. 2015;22(10):903-12. | ||||
| Ref 533846 | Dose-dependent pharmacokinetics of L-693,612, a carbonic anhydrase inhibitor, following oral administration in rats. Pharm Res. 1994 Mar;11(3):438-41. | ||||
| Ref 535861 | Inhibition of carbonic anhydrases I and II by N-unsubstituted carbamate esters. J Biol Chem. 1992 Dec 15;267(35):25044-50. | ||||
| Ref 537461 | Carbonic anhydrase inhibitors. Inhibition studies of a coral secretory isoform by sulfonamides. Bioorg Med Chem. 2009 Jul 15;17(14):5054-8. Epub 2009 May 30. | ||||
| Ref 538055 | Sulfenamido-sulfonamides as inhibitors of carbonic anhydrase isozymes I, II and IV. J Enzyme Inhib. 1997 Aug;12(3):175-90. | ||||
| Ref 538135 | Carbonic anhydrase inhibitors: inhibition of isozymes I, II and IV with N-hydroxysulfonamides--a novel class of intraocular pressure lowering agents. J Enzyme Inhib. 1998 Jul;13(4):267-84. | ||||
| Ref 543654 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2597). | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.