Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T03573
|
||||
Former ID |
TTDNC00464
|
||||
Target Name |
CD32b
|
||||
Gene Name |
FCGR2B
|
||||
Synonyms |
CD32; CDw32; FcRIIb; Fcgamma RIIb; FcgammaRIIb; IgG Fc receptor IIb; Low affinity immunoglobulin gamma Fc region receptor IIb; FCGR2B
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Autoimmune diabetes [ICD10: E08-E13] | ||||
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
Function |
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B- cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells (TCR) or via another Fc receptor. Isoform IIB1 fails to mediate endocytosis or phagocytosis. Isoform IIB2 does not trigger phagocytosis.
|
||||
UniProt ID | |||||
Sequence |
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWIN
VLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSL SDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN FSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAA VVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDA LEEPDDQNRI |
||||
Drugs and Mode of Action | |||||
Pathways | |||||
KEGG Pathway | Phagosome | ||||
Osteoclast differentiation | |||||
B cell receptor signaling pathway | |||||
Fc gamma R-mediated phagocytosis | |||||
Staphylococcus aureus infection | |||||
Tuberculosis | |||||
Measles | |||||
NetPath Pathway | Leptin Signaling Pathway | ||||
Pathway Interaction Database | Fc-epsilon receptor I signaling in mast cells | ||||
BCR signaling pathway | |||||
Reactome | Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | ||||
WikiPathways | Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | ||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.