Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID | T55922 | ||||
| Former ID | TTDR00414 | ||||
| Target Name | S-adenosylmethioninedecarboxylase proenzyme | ||||
| Gene Name | AMD1 | ||||
| Synonyms | AdoMetDC; S-adenosylmethioninedecarboxylase; SamDC; AMD1 | ||||
| Target Type | Clinical Trial | ||||
| Disease | Burns and burn infection [ICD9: 001-139; ICD10: A00-B99] | ||||
| Head and neck cancer [ICD9: 140-149, 140-229; ICD10: C07-C14, C32-C33] | |||||
| Pneumocystis carinii infection [ICD10: B59] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function | Essential for biosynthesis of the polyamines spermidine and spermine. Promotes maintenance and self-renewal of embryonic stem cells, by maintaining spermine levels (By similarity). | ||||
| BioChemical Class | Carbon-carbon lyase | ||||
| Target Validation | T55922 | ||||
| UniProt ID | |||||
| EC Number | EC 4.1.1.50 | ||||
| Sequence | MEAAHFFEGTEKLLEVWFSRQQPDANQGSGDLRTIPRSEWDILLKDVQCSIISVTKTDKQ EAYVLSESSMFVSKRRFILKTCGTTLLLKALVPLLKLARDYSGFDSIQSFFYSRKNFMKP SHQGYPHRNFQEEIEFLNAIFPNGAAYCMGRMNSDCWYLYTLDFPESRVISQPDQTLEIL MSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATMFNPCGYSMNGMKSDGTYW TIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCRTVLASPQ KIEGFKRLDCQSAMFNDYNFVFTSFAKKQQQQQS | ||||
| Drugs and Mode of Action | |||||
| Inhibitor | 5'-([(Z)-4-amino-2-butenyl]methylamino)-5'-deoxyadenosine | Drug Info | [535793] | ||
| 5'-Deoxy-5'-(N,N-dimethylamino)-8-methyladenosine | Drug Info | [529959] | |||
| 5'-Deoxy-5'-(N,N-dimethylamino)adenosine | Drug Info | [529959] | |||
| 5'-Deoxy-5'-dimethylsulfonioadenosine chloride | Drug Info | [529959] | |||
| 5'-deoxy-5'-[(3-hydrazinopropyl)methylamino]adenosine | Drug Info | [535793] | |||
| Guanylhydrazone | Drug Info | [538021] | |||
| Hydroxyalanine | Drug Info | [551391] | |||
| MGBG | Drug Info | [535032], [535955] | |||
| Putrescine | Drug Info | [551393] | |||
| SAM486A | Drug Info | [535032] | |||
| Tris(Hydroxymethyl)Aminomethane | Drug Info | [551393] | |||
| [(2-aminooxyethyl)methylamino]-5'-deoxyadenosine | Drug Info | [529959] | |||
| Modulator | CGP-40215A | Drug Info | [534214], [535793] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| BioCyc Pathway | Methionine salvage cycle III | ||||
| Spermine biosynthesis | |||||
| Spermidine biosynthesis | |||||
| KEGG Pathway | Cysteine and methionine metabolism | ||||
| Arginine and proline metabolism | |||||
| Metabolic pathways | |||||
| NetPath Pathway | EGFR1 Signaling Pathway | ||||
| PathWhiz Pathway | Spermidine and Spermine Biosynthesis | ||||
| Methionine Metabolism | |||||
| WikiPathways | Metabolism of amino acids and derivatives | ||||
| References | |||||
| Ref 525957 | Spermine deficiency resulting from targeted disruption of the spermine synthase gene in embryonic stem cells leads to enhanced sensitivity to antiproliferative drugs. Mol Pharmacol. 2001 Feb;59(2):231-8. | ||||
| Ref 534214 | Antileishmanial effect of a potent S-adenosylmethionine decarboxylase inhibitor: CGP 40215A. Pharmacol Res. 1996 Jan;33(1):67-70. | ||||
| Ref 535793 | S-adenosylmethionine decarboxylase as an enzyme target for therapy. Pharmacol Ther. 1992 Dec;56(3):359-77. | ||||
| Ref 539518 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2388). | ||||
| Ref 529959 | J Med Chem. 2009 Mar 12;52(5):1388-407.New insights into the design of inhibitors of human S-adenosylmethionine decarboxylase: studies of adenine C8 substitution in structural analogues of S-adenosylmethionine. | ||||
| Ref 534214 | Antileishmanial effect of a potent S-adenosylmethionine decarboxylase inhibitor: CGP 40215A. Pharmacol Res. 1996 Jan;33(1):67-70. | ||||
| Ref 535032 | A phase I study of a new polyamine biosynthesis inhibitor, SAM486A, in cancer patients with solid tumours. Br J Cancer. 2000 Sep;83(5):594-601. | ||||
| Ref 535793 | S-adenosylmethionine decarboxylase as an enzyme target for therapy. Pharmacol Ther. 1992 Dec;56(3):359-77. | ||||
| Ref 535955 | New S-adenosylmethionine decarboxylase inhibitors with potent antitumor activity. Cancer Res. 1992 Sep 1;52(17):4712-8. | ||||
| Ref 538021 | CGP 48664, a potent and specific S-adenosylmethionine decarboxylase inhibitor: effects on regulation and stability of the enzyme. Biochem J. 1997 Feb 15;322 ( Pt 1):297-302. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.
