Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T98459
|
||||
Former ID |
TTDR00152
|
||||
Target Name |
G2/mitotic-specific cyclin B1
|
||||
Gene Name |
CCNB1
|
||||
Synonyms |
Cyclin B1; CCNB1
|
||||
Target Type |
Research
|
||||
Function |
Essential for the control of the cell cycle at the G2/M (mitosis) transition.
|
||||
Target Validation |
T98459
|
||||
UniProt ID | |||||
Sequence |
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKM
PMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPI LVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQ LEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVP KKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE WTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS ALVQDLAKAVAKV |
||||
Inhibitor | 3,4-bis(indol-3-yl)maleimide derivative | Drug Info | [534788] | ||
3,4-di-(4-methoxyphenyl)-1H-pyrrole-2,5-dione | Drug Info | [528032] | |||
3,4-diphenyl-1H-pyrrole-2,5-dione | Drug Info | [528032] | |||
3-(4-methoxyphenyl)-4-phenyl-1H-pyrrole-2,5-dione | Drug Info | [528032] | |||
3-(indole-3-yl)-4-phenyl-1H-pyrrole-2,5-dione | Drug Info | [528032] | |||
4-(Quinolin-3-yl)-N-p-tolylpyrimidin-2-amine | Drug Info | [530491] | |||
4-(Quinolin-4-yl)-N-p-tolylpyrimidin-2-amine | Drug Info | [530491] | |||
AZAKENPAULLONE | Drug Info | [526916] | |||
GF-109203 | Drug Info | [534788] | |||
KENPAULLONE | Drug Info | [531040] | |||
RO-316233 | Drug Info | [534788] | |||
Thieno analogue of kenpaullone | Drug Info | [526916] | |||
Pathways | |||||
KEGG Pathway | FoxO signaling pathway | ||||
Cell cycle | |||||
Oocyte meiosis | |||||
p53 signaling pathway | |||||
Progesterone-mediated oocyte maturation | |||||
NetPath Pathway | TCR Signaling Pathway | ||||
PANTHER Pathway | p53 pathway | ||||
Pathway Interaction Database | p73 transcription factor network | ||||
Validated targets of C-MYC transcriptional activation | |||||
PLK1 signaling events | |||||
FoxO family signaling | |||||
Direct p53 effectors | |||||
FOXM1 transcription factor network | |||||
C-MYB transcription factor network | |||||
Reactome | Polo-like kinase mediated events | ||||
Golgi Cisternae Pericentriolar Stack Reorganization | |||||
Regulation of APC/C activators between G1/S and early anaphase | |||||
Phosphorylation of the APC/C | |||||
Phosphorylation of Emi1 | |||||
Condensation of Prophase Chromosomes | |||||
MASTL Facilitates Mitotic Progression | |||||
Resolution of Sister Chromatid Cohesion | |||||
Condensation of Prometaphase Chromosomes | |||||
Regulation of PLK1 Activity at G2/M Transition | |||||
Activation of NIMA Kinases NEK9, NEK6, NEK7 | |||||
Recruitment of NuMA to mitotic centrosomes | |||||
Depolymerisation of the Nuclear Lamina | |||||
Cyclin A/B1 associated events during G2/M transition | |||||
G2/M DNA replication checkpoint | |||||
Cdk1 complex | |||||
WikiPathways | DNA Damage Response | ||||
G1 to S cell cycle control | |||||
Mitotic Prophase | |||||
Mitotic Prometaphase | |||||
ATM Signaling Pathway | |||||
Retinoblastoma (RB) in Cancer | |||||
Mitotic G2-G2/M phases | |||||
Mitotic G1-G1/S phases | |||||
Cell Cycle | |||||
APC/C-mediated degradation of cell cycle proteins | |||||
Cell Cycle Checkpoints | |||||
miRNA Regulation of DNA Damage Response | |||||
AMPK Signaling | |||||
References | |||||
Ref 526916 | Bioorg Med Chem Lett. 2004 Jan 19;14(2):413-6.1-Azakenpaullone is a selective inhibitor of glycogen synthase kinase-3 beta. | ||||
Ref 528032 | J Med Chem. 2006 Feb 23;49(4):1271-81.Design, synthesis, and biological evaluation of 3,4-diarylmaleimides as angiogenesis inhibitors. | ||||
Ref 530491 | Eur J Med Chem. 2010 Jan;45(1):379-86. Epub 2009 Oct 13.Synthesis and cytotoxic activity of 2-methylimidazo[1,2-a]pyridine- and quinoline-substituted 2-aminopyrimidine derivatives. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.