Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T92521
|
||||
Former ID |
TTDR00242
|
||||
Target Name |
Cytochrome P450 1B1
|
||||
Gene Name |
CYP1B1
|
||||
Synonyms |
CYPIB1; CYP1B1
|
||||
Target Type |
Clinical Trial
|
||||
Function |
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids,fatty acids, retinoid and xenobiotics. Preferentially oxidizes 17beta- estradiol to the carcinogenic 4-hydroxy derivative, and a variety of procarcinogenic compounds to their activated forms, including polycyclic aromatic hydrocarbons. Promotes angiogenesis by removing cellular oxygenation products, thereby decreasing oxidative stress, release of antiangiogenic factor THBS2, then allowing endothelial cells migration, cell adhesion and capillary morphogenesis. These changes are concommitant with the endothelial nitric oxide synthase activity and nitric oxide synthesis. Plays an important role in the regulation of perivascular cell proliferation, migration, and survival through modulation of the intracellular oxidative state and NF-kappa-B expression and/or activity, during angiogenesis. Contributes to oxidative homeostasis and ultrastructural organization and function of trabecular meshwork tissue through modulation of POSTN expression.
|
||||
BioChemical Class |
Oxidoreductases acting on paired donors
|
||||
Target Validation |
T92521
|
||||
UniProt ID | |||||
EC Number |
EC 1.14.14.1
|
||||
Sequence |
MGTSLSPNDPWPLNPLSIQQTTLLLLLSVLATVHVGQRLLRQRRRQLRSAPPGPFAWPLI
GNAAAVGQAAHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPAF ASFRVVSGGRSMAFGHYSEHWKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVAL LVRGSADGAFLDPRPLTVVAVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSL VDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHCESLRPGAAPRDMMDAFILSA EKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYPDVQTRVQAEL DQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVV FVNQWSVNHDPLKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQL FLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKE TCQ |
||||
Drugs and Mode of Action | |||||
Inhibitor | 2-[2-(3,5-Dimethoxy-phenyl)-vinyl]-thiophene | Drug Info | [526231] | ||
3-[2-(3,5-Dimethoxy-phenyl)-vinyl]-furan | Drug Info | [526231] | |||
4-[2-(3,5-Dimethoxy-phenyl)-vinyl]-pyridine | Drug Info | [526231] | |||
ACACETIN | Drug Info | [531094] | |||
APIGENIN | Drug Info | [531094] | |||
CHRYSIN | Drug Info | [531094] | |||
CHRYSOERIOL | Drug Info | [531094] | |||
DIOSMETIN | Drug Info | [531094] | |||
ERIODICTYOL | Drug Info | [531094] | |||
GALANGIN | Drug Info | [531094] | |||
HOMOERIODICTYOL | Drug Info | [531094] | |||
ISORHAMNETIN | Drug Info | [531094] | |||
ISOSAKUTANETIN | Drug Info | [531094] | |||
KAEMPFERIDE | Drug Info | [531094] | |||
KAEMPFEROL | Drug Info | [531094] | |||
N-(2,4-Dimethoxy-phenyl)-3,5-dimethoxy-benzamide | Drug Info | [526231] | |||
NARINGENIN | Drug Info | [531094] | |||
PINOCEMBRIN | Drug Info | [531094] | |||
TAMARIXETIN | Drug Info | [531094] | |||
TRISMETHOXYRESVERATROL | Drug Info | [526231] | |||
Pathways | |||||
BioCyc Pathway | Superpathway of tryptophan utilization | ||||
Superpathway of melatonin degradation | |||||
Melatonin degradation I | |||||
KEGG Pathway | Steroid hormone biosynthesis | ||||
Tryptophan metabolism | |||||
Metabolism of xenobiotics by cytochrome P450 | |||||
Ovarian steroidogenesis | |||||
Chemical carcinogenesis | |||||
MicroRNAs in cancer | |||||
NetPath Pathway | TSH Signaling Pathway | ||||
IL4 Signaling Pathway | |||||
TGF_beta_Receptor Signaling Pathway | |||||
Reactome | Endogenous sterols | ||||
WikiPathways | Metapathway biotransformation | ||||
Estrogen metabolism | |||||
Benzo(a)pyrene metabolism | |||||
Tamoxifen metabolism | |||||
Tryptophan metabolism | |||||
Oxidation by Cytochrome P450 | |||||
Nuclear Receptors Meta-Pathway | |||||
Estrogen Receptor Pathway | |||||
Sulindac Metabolic Pathway | |||||
Arylhydrocarbon receptor (AhR) signaling pathway | |||||
miR-targeted genes in muscle cell - TarBase | |||||
miR-targeted genes in lymphocytes - TarBase | |||||
miR-targeted genes in epithelium - TarBase | |||||
miR-targeted genes in adipocytes - TarBase | |||||
Phase 1 - Functionalization of compounds | |||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.