Target General Infomation
Target ID
T91173
Former ID
TTDR01344
Target Name
mRNA of Inhibitor-kappa B Kinase-alpha
Gene Name
CHUK
Synonyms
CHUK (mRNA); Conserved helixloophelix ubiquitous kinase (mRNA); IKK1 (mRNA); IKKA (mRNA); IKKalpha (mRNA); IkBKA (mRNA); IkappaB kinase (mRNA); IkappaB kinase 1 (mRNA); IkappaB kinase alpha (mRNA); Inhibitor of nuclear factor kappaB kinase subunit alpha (mRNA); NFKBIKA (mRNA); Nuclear factor NFkappaB inhibitor kinase alpha (mRNA); TCF16 (mRNA); Transcription factor 16 (mRNA); CHUK
Target Type
Research
Function
Serine kinase that plays an essential role in the NF- kappa-B signaling pathway which is activated by multiple stimuli such as inflammatory cytokines, bacterial or viral products, DNA damagesor other cellular stresses. Acts as part of the canonical IKK complex in the conventional pathway of NF-kappa-B activation and phosphorylates inhibitors of NF-kappa-B on serine residues. These modifications allow polyubiquitination of the inhibitors and subsequent degradation by the proteasome. In turn, free NF-kappa-B is translocated into the nucleus and activates the transcription of hundreds of genes involved in immune response, growth control, or protection against apoptosis. Negatively regulates the pathway by phosphorylating the scaffold protein TAXBP1 and thus promoting the assembly ofthe A20/TNFAIP3 ubiquitin-editing complex (composed of A20/TNFAIP3, TAX1BP1, and the E3 ligases ITCH and RNF11). Therefore, CHUK plays a key role in the negative feedback of NF-kappa-B canonical signaling to limit inflammatory gene activation. As part of the non-canonical pathway of NF-kappa-B activation, the MAP3K14-activated CHUK/IKKA homodimer phosphorylates NFKB2/p100 associated with RelB, inducing its proteolytic processing to NFKB2/p52 and the formation of NF-kappa- B RelB-p52 complexes. In turn, these complexes regulate genes encoding molecules involved in B-cell survival and lymphoid organogenesis. Participates also in the negative feedback of the non-canonical NF-kappa-B signaling pathway by phosphorylating and destabilizing MAP3K14/NIK. Within the nucleus, phosphorylates CREBBP and consequently increases both its transcriptional and histone acetyltransferase activities. Modulates chromatin accessibility at NF-kappa-B-responsive promoters by phosphorylating histones H3 at 'Ser-10' that are subsequently acetylated at 'Lys-14' by CREBBP. Additionally, phosphorylates the CREBBP-interacting protein NCOA3.
BioChemical Class
Kinase
Target Validation
T91173
UniProt ID
EC Number
EC 2.7.11.10
Sequence
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMSGEVRFSSHLPQPNSLCSLVVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHL
STIIHEANEEQGNSMMNLDWSWLTE
Inhibitor 5-Bromo-6-methoxy-9H-beta-carboline Drug Info [526654]
N-(4-amino-5-cyano-6-phenylpyridin-2-yl)acetamide Drug Info [528237]
Pathways
KEGG Pathway MAPK signaling pathway
Ras signaling pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Hepatitis C
Hepatitis B
Measles
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Pancreatic cancer
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
NetPath Pathway IL5 Signaling Pathway
FSH Signaling Pathway
PANTHER Pathway Apoptosis signaling pathway
B cell activation
Inflammation mediated by chemokine and cytokine signaling pathway
Interleukin signaling pathway
PDGF signaling pathway
T cell activation
Toll receptor signaling pathway
Pathway Interaction Database Fc-epsilon receptor I signaling in mast cells
BCR signaling pathway
TCR signaling in na&amp
#xef
ve CD4+ T cells
Canonical NF-kappaB pathway
Alternative NF-kappaB pathway
Osteopontin-mediated events
TRAIL signaling pathway
TCR signaling in na&amp
ve CD8+ T cells
FAS (CD95) signaling pathway
IL1-mediated signaling events
TNF receptor signaling pathway
FoxO family signaling
p75(NTR)-mediated signaling
Negative effector of Fas and TNF-alpha
Validated nuclear estrogen receptor alpha network
Class I PI3K signaling events mediated by Akt
Validated transcriptional targets of TAp63 isoforms
Endogenous TLR signaling
PathWhiz Pathway Intracellular Signalling Through Adenosine Receptor A2a and Adenosine
Intracellular Signalling Through Adenosine Receptor A2b and Adenosine
Reactome Activation of NF-kappaB in B cells
NOD1/2 Signaling Pathway
RIP-mediated NFkB activation via ZBP1
AKT phosphorylates targets in the cytosol
FCERI mediated NF-kB activation
TAK1 activates NFkB by phosphorylation and activation of IKKs complex
Interleukin-1 signaling
Regulation of TNFR1 signaling
TNFR1-induced NFkappaB signaling pathway
IKBKB deficiency causes SCID
IKBKG deficiency causes anhidrotic ectodermal dysplasia with immunodeficiency (EDA-ID) (via TLR)
IkBA variant leads to EDA-ID
Dectin-1 mediated noncanonical NF-kB signaling
CLEC7A (Dectin-1) signaling
Constitutive Signaling by AKT1 E17K in Cancer
NIK--&gt
noncanonical NF-kB signaling
MAP3K8 (TPL2)-dependent MAPK1/3 activation
TRAF6 mediated NF-kB activation
NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10
IRAK1 recruits IKK complex
IKK complex recruitment mediated by RIP1
IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation
WikiPathways PDGF Pathway
References
Ref 526654Bioorg Med Chem Lett. 2003 Jul 21;13(14):2419-22.Novel IKK inhibitors: beta-carbolines.
Ref 528237J Med Chem. 2006 Jun 15;49(12):3563-80.Aminopyridine-based c-Jun N-terminal kinase inhibitors with cellular activity and minimal cross-kinase activity.
Ref 549651US patent application no. 6,395,545, Antisense modulation of inhibitor-kappa B kinase-alpha expression.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.