Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T74952
|
||||
Former ID |
TTDR00978
|
||||
Target Name |
CAMP-dependent protein kinase type II-beta regulatory chain
|
||||
Gene Name |
PRKAR2B
|
||||
Synonyms |
PKA RIIbeta-subunit; RIIbeta subunit of cAMP-dependent protein kinase; Type RIIbeta regulatory subunit of protein kinase A; PRKAR2B
|
||||
Target Type |
Discontinued
|
||||
Function |
Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells. Type II regulatory chains mediate membrane association by binding to anchoring proteins, including the MAP2 kinase.
|
||||
BioChemical Class |
Kinase
|
||||
Target Validation |
T74952
|
||||
UniProt ID | |||||
EC Number |
EC 2.7.1.37
|
||||
Sequence |
MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGD
LGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAY NPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEH VIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATS PGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDG EQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKP RAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA |
||||
Drugs and Mode of Action | |||||
Inhibitor | 4-[(3,5-diamino-1H-pyrazol-4-yl)diazenyl]phenol | Drug Info | [528490] | ||
AdcAhxArg4Lys(biotin)-PEG-OMe | Drug Info | [526704] | |||
AdcAhxArg4Lys-PEGOMe | Drug Info | [526704] | |||
AdcAhxArg4NH(CH2)6NH2 | Drug Info | [526704] | |||
AdcAhxArg6 | Drug Info | [526704] | |||
AdoC(Ahx)Arg6 | Drug Info | [525511] | |||
AdoC(Aoc)Arg6 | Drug Info | [525511] | |||
AdoC(Aun)Arg6 | Drug Info | [525511] | |||
AdoC(beta-Ala)2AlaArg6 | Drug Info | [525511] | |||
AdoC(beta-Ala)Arg6 | Drug Info | [525511] | |||
AdoC(betaAsp)2AlaArg6 | Drug Info | [525511] | |||
AdoC(Dpr)2AlaArg6 | Drug Info | [525511] | |||
AdoC(GABA)Arg6 | Drug Info | [525511] | |||
AdoCGlyArg6 | Drug Info | [525511] | |||
BALANOL | Drug Info | [527710] | |||
Cyclic Adenosine Monophosphate | Drug Info | [551393] | |||
Ro-4396686 | Drug Info | [528018] | |||
Pathways | |||||
KEGG Pathway | Apoptosis | ||||
Insulin signaling pathway | |||||
PANTHER Pathway | Endothelin signaling pathway | ||||
Hedgehog signaling pathway | |||||
Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | |||||
Metabotropic glutamate receptor group III pathway | |||||
Metabotropic glutamate receptor group II pathway | |||||
Muscarinic acetylcholine receptor 2 and 4 signaling pathway | |||||
Transcription regulation by bZIP transcription factor | |||||
5HT1 type receptor mediated signaling pathway | |||||
Beta1 adrenergic receptor signaling pathway | |||||
Beta2 adrenergic receptor signaling pathway | |||||
Histamine H2 receptor mediated signaling pathway | |||||
GABA-B receptor II signaling | |||||
Dopamine receptor mediated signaling pathway | |||||
Enkephalin release | |||||
Reactome | PKA activation | ||||
PKA activation in glucagon signalling | |||||
DARPP-32 events | |||||
Regulation of PLK1 Activity at G2/M Transition | |||||
Loss of Nlp from mitotic centrosomes | |||||
Recruitment of mitotic centrosome proteins and complexes | |||||
Loss of proteins required for interphase microtubule organization?from the centrosome | |||||
Glucagon-like Peptide-1 (GLP1) regulates insulin secretion | |||||
Vasopressin regulates renal water homeostasis via Aquaporins | |||||
Hedgehog ' | |||||
off' | |||||
state | |||||
Anchoring of the basal body to the plasma membrane | |||||
Factors involved in megakaryocyte development and platelet production | |||||
WikiPathways | SIDS Susceptibility Pathways | ||||
Calcium Regulation in the Cardiac Cell | |||||
G Protein Signaling Pathways | |||||
Myometrial Relaxation and Contraction Pathways | |||||
DAG and IP3 signaling | |||||
Regulation of Water Balance by Renal Aquaporins | |||||
miRs in Muscle Cell Differentiation | |||||
Opioid Signalling | |||||
Mitotic G2-G2/M phases | |||||
Integration of energy metabolism | |||||
Factors involved in megakaryocyte development and platelet production | |||||
References | |||||
Ref 525511 | Bioorg Med Chem Lett. 1999 May 17;9(10):1447-52.Adenosine-5'-carboxylic acid peptidyl derivatives as inhibitors of protein kinases. | ||||
Ref 526704 | Bioorg Med Chem Lett. 2003 Sep 15;13(18):3035-9.Liquid-phase synthesis of a pegylated adenosine-oligoarginine conjugate, cell-permeable inhibitor of cAMP-dependent protein kinase. | ||||
Ref 527710 | J Med Chem. 2005 Sep 8;48(18):5613-38.Joys of molecules. 2. Endeavors in chemical biology and medicinal chemistry. | ||||
Ref 528018 | Bioorg Med Chem Lett. 2006 Apr 1;16(7):1950-3. Epub 2006 Feb 3.Biological evaluation of a multi-targeted small molecule inhibitor of tumor-induced angiogenesis. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.