Target General Infomation
Target ID
T70680
Former ID
TTDS00504
Target Name
Organic anion transporter 1
Gene Name
SLC22A8
Synonyms
OAT1; PAH transporter; PAHT; Renal organic anion transporter 1; SLC22A6; Solute carrier family 22 member 6; hOAT1; hPAHT; hROAT1; SLC22A8
Target Type
Successful
Disease Gout; Hyperuricemia [ICD9: 274, 790.6; ICD10: E79.0, M10]
Ocular disease [ICD10: H00-H59]
Obesity [ICD9: 278; ICD10: E66]
Function
Involved in the renal elimination of endogenous and exogenous organic anions. Functions as organic anion exchanger when the uptake of one molecule of organic anion is coupled with an efflux of one molecule of endogenous dicarboxylic acid (glutarate, ketoglutarate, etc).
BioChemical Class
Major facilitator superfamily
Target Validation
T70680
UniProt ID
Sequence
MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPW
VLPMGPNGKPERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNK
LKEMAQSIFMAGILIGGLVLGDLSDRFGRRPILTCSYLLLAASGSGAAFSPTFPIYMVFR
FLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAYAIPQWRWLQL
TVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELKLN
LQKEISLAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEEFGVNLYILQI
IFGGVDVPAKFITILSLSYLGRHTTQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKG
CLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRVGSMVSPLVKITGEVQPFIPNIIYGI
TALLGGSAALFLPETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLG
SS
Drugs and Mode of Action
Drug(s) FLUORESCEIN Drug Info Approved Ocular disease [551871]
Probenecid Drug Info Approved Gout; Hyperuricemia [467694], [538403], [551871]
Buproprion+zonisamide Drug Info Phase 2 Obesity [548326]
Inhibitor 3R14S-OCHRATOXIN A Drug Info [528881]
ADIPATE Drug Info [528881]
AMINOHIPPURIC ACID Drug Info [528881]
FLUORESCEIN Drug Info [528881]
GLUTARATE Drug Info [528881]
HEPTANOATE Drug Info [528881]
Blocker Buproprion+zonisamide Drug Info [536710]
Probenecid Drug Info [535702], [537720]
Pathways
PathWhiz Pathway Kidney Function
References
Ref 467694(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4357).
Ref 538403FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 007898.
Ref 548326Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024638)
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 528881J Biol Chem. 2007 Aug 17;282(33):23841-53. Epub 2007 Jun 5.Structural variation governs substrate specificity for organic anion transporter (OAT) homologs. Potential remote sensing by OAT family members.
Ref 535702Transport of organic anions across the basolateral membrane of proximal tubule cells. Rev Physiol Biochem Pharmacol. 2003;146:95-158. Epub 2003 Jan 30.
Ref 536710Anti-obesity drugs. Expert Opin Pharmacother. 2008 Jun;9(8):1339-50.
Ref 537720Interactions of organic anions with the organic cation transporter in renal BBMV. Am J Physiol. 1988 Jan;254(1 Pt 2):F56-61.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.