Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T60744
|
||||
| Former ID |
TTDR00119
|
||||
| Target Name |
Orexin
|
||||
| Gene Name |
HCRT
|
||||
| Synonyms |
Hcrt; Hypocretin; HCRT
|
||||
| Target Type |
Research
|
||||
| Function |
Neuropeptides that play a significant role in the regulationof food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids, is also suggested. Orexin-A binds to both OX1R and OX2R with a high affinity, whereas orexin-B binds only to OX2R with a similar high affinity.
|
||||
| UniProt ID | |||||
| Sequence |
MNLPSTKVSWAAVTLLLLLLLLPPALLSSGAAAQPLPDCCRQKTCSCRLYELLHGAGNHA
AGILTLGKRRSGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRPCLGRRCSAPAA ASVAPGGQSGI |
||||
| Pathways | |||||
| References | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.