Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T41666
|
||||
Former ID |
TTDR00219
|
||||
Target Name |
Hypoxanthine-guanine phosphoribosyltransferase
|
||||
Gene Name |
LACZ
|
||||
Synonyms |
GPRT; Guanine phosphoribosyltransferase; HGPRT; HGPRTase; HPRT; Hypoxanthine phosphoribosyltransferase; LACZ
|
||||
Target Type |
Research
|
||||
Function |
Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5- phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway.
|
||||
BioChemical Class |
Pentosyltransferase
|
||||
Target Validation |
T41666
|
||||
UniProt ID | |||||
EC Number |
EC 2.4.2.8
|
||||
Sequence |
MPIPNNPGAGENAFDPVFVNDDDGYDLDSFMIPAHYKKYLTKVLVPNGVIKNRIEKLAYD
IKKVYNNEEFHILCLLKGSRGFFTALLKHLSRIHNYSAVETSKPLFGEHYVRVKSYCNDQ STGTLEIVSEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFIKRTPL WNGFKADFVGFSIPDHFVVGYSLDYNEIFRDLDHCCLVNDEGKKKYKATSL |
||||
Structure |
1CJB; 2VFA; 3OZF; 3OZG; 1BZY; 1D6N; 1HMP; 1Z7G; 2VFA; 3GEP; 3GGC; 3GGJ; 4IJQ; 4KN6; 4RAB; 4RAC; 4RAD; 4RAN; 4RAO; 4RAQ
|
||||
Inhibitor | 3h-Pyrazolo[4,3-D]Pyrimidin-7-Ol | Drug Info | [551393] | ||
5--Monophosphate-9-Beta-D-Ribofuranosyl Xanthine | Drug Info | [551393] | |||
7-Hydroxy-Pyrazolo[4,3-D]Pyrimidine | Drug Info | [551391] | |||
9-Deazaguanine | Drug Info | [551393] | |||
9-[2-(1-Phosphonobutan-2-yloxy)ethyl]guanine | Drug Info | [530305] | |||
9-[2-(1-Phosphonobutan-2-yloxy)ethyl]hypoxanthine | Drug Info | [530305] | |||
9-[2-(1-Phosphonopropan-2-yloxy)ethyl]guanine | Drug Info | [530305] | |||
Acetate Ion | Drug Info | [551393] | |||
Alpha-Phosphoribosylpyrophosphoric Acid | Drug Info | [551374] | |||
Carboxylic PRPP | Drug Info | [551393] | |||
Formic Acid | Drug Info | [551393] | |||
Formycin B | Drug Info | [551393] | |||
Guanosine-5',3'-Tetraphosphate | Drug Info | [551393] | |||
Guanosine-5'-Monophosphate | Drug Info | [551393] | |||
Inosinic Acid | Drug Info | [551393] | |||
Pyrophosphate 2- | Drug Info | [551374] | |||
Pathways | |||||
KEGG Pathway | Purine metabolism | ||||
Drug metabolism - other enzymes | |||||
Metabolic pathways | |||||
PathWhiz Pathway | Purine Metabolism | ||||
Reactome | Purine salvage | ||||
WikiPathways | Nucleotide Metabolism | ||||
Mesodermal Commitment Pathway | |||||
Endoderm Differentiation | |||||
Metabolism of nucleotides | |||||
References | |||||
Ref 530305 | Bioorg Med Chem. 2009 Sep 1;17(17):6218-32. Epub 2009 Jul 25.Synthesis of branched 9-[2-(2-phosphonoethoxy)ethyl]purines as a new class of acyclic nucleoside phosphonates which inhibit Plasmodium falciparum hypoxanthine-guanine-xanthine phosphoribosyltransferase. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.