Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T40730
|
||||
| Former ID |
TTDR00690
|
||||
| Target Name |
Dihydroneopterinaldolase
|
||||
| Gene Name |
folB
|
||||
| Synonyms |
7,8-Dihydroneopterin aldolase; DHNA; FOLB; folB
|
||||
| Target Type |
Research
|
||||
| Function |
Catalyzes the conversion of 7,8-dihydroneopterin to 6- hydroxymethyl-7,8-dihydropterin. Can use L-threo-dihydroneopterin and D-erythro-dihydroneopterin as substrates for the formation of 6-hydroxymethyldihydropterin,but it can also catalyze the epimerization of carbon 2' of dihydroneopterin and dihydromonapterin at appreciable velocity.
|
||||
| BioChemical Class |
Carbon-carbon lyase
|
||||
| UniProt ID | |||||
| EC Number |
EC 4.1.2.25
|
||||
| Sequence |
MDIVFIEQLSVITTIGVYDWEQTIEQKLVFDIEMAWDNRKAAKSDDVADCLSYADIAETV
VSHVEGARFALVERVAEEVAELLLARFNSPWVRIKLSKPGAVARAANVGVIIERGNNLKE NN |
||||
| Inhibitor | 2-Amino-5-Bromo-6-Phenylpyrimidin-4-Ol | Drug Info | [551393] | ||
| 6-Hydroxymethyl-7,8-Dihydropterin | Drug Info | [551393] | |||
| 7,8-dihydrobiopterin | Drug Info | [551393] | |||
| 7,8-Dihydroneopterin | Drug Info | [551393] | |||
| 8-Amino-1,3-Dimethyl-3,7-Dihydropurine-2,6-Dione | Drug Info | [551393] | |||
| 9-Methylguanine | Drug Info | [551393] | |||
| References | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.