Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T40694
|
||||
Former ID |
TTDC00160
|
||||
Target Name |
Serine/threonine-protein kinase PLK1
|
||||
Gene Name |
PLK1
|
||||
Synonyms |
Mitoticserine-threonine kinase polo-like kinase 1; PLK-1; Plk1; Polo-like kinase 1; STPK13; Serine-threonine protein kinase 13; PLK1
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Advanced solid tumor; Non-hodgkin's lymphoma [ICD9: 140-199, 200, 202, 202.8, 210-229; ICD10: C00-C75, C7A, C7B, C81-C86, C82-C85, D10-D36, D3A] | ||||
Acute myeloid leukemia [ICD9: 205; ICD10: C92.0] | |||||
Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
Lymphoma [ICD9: 202.8, 208.9; ICD10: C81-C86] | |||||
Pancreatic cancer; Prostate cancer [ICD9: 157, 185; ICD10: C25, C61] | |||||
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
Function |
Serine/threonine-protein kinase that performs several important functions throughout M phase of the cell cycle, including the regulation of centrosome maturation and spindle assembly, the removal of cohesinsfrom chromosome arms, the inactivation of anaphase-promoting complex/cyclosome (APC/C) inhibitors, and the regulation of mitotic exit and cytokinesis. Polo-like kinase proteins acts by binding and phosphorylating proteins are that already phosphorylated on a specific motif recognized by the POLO box domains. Phosphorylates BORA, BUB1B/BUBR1, CCNB1, CDC25C, CEP55, ECT2, ERCC6L, FBXO5/EMI1, FOXM1, KIF20A/MKLP2, CENPU, NEDD1, NINL, NPM1, NUDC, PKMYT1/MYT1, KIZ, PPP1R12A/MYPT1, PRC1, RACGAP1/CYK4, SGOL1, STAG2/SA2, TEX14, TOPORS, p73/TP73, TPT1 and WEE1. Plays a key role in centrosome functions and the assembly of bipolar spindles by phosphorylating KIZ, NEDD1 and NINL. NEDD1 phosphorylation promotes subsequent targeting of the gamma-tubulin ring complex (gTuRC) to the centrosome, an important step for spindle formation. Phosphorylation of NINL component of the centrosome leads to NINL dissociation from other centrosomal proteins.
|
||||
BioChemical Class |
Kinase
|
||||
Target Validation |
T40694
|
||||
UniProt ID | |||||
EC Number |
EC 2.7.11.21
|
||||
Sequence |
MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLG
KGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFF EDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLG NLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCI MYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELL NDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEE PVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDK YGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLK YFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTK LILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRL KAS |
||||
Drugs and Mode of Action | |||||
Drug(s) | Rigosertib | Drug Info | Phase 3 | Solid tumours | [532659], [542777] |
BI 2536 | Drug Info | Phase 2 | Acute myeloid leukemia | [522354], [541009] | |
Volasertib | Drug Info | Phase 2 | Acute myeloid leukemia | [524843], [542862] | |
GSK461364 | Drug Info | Phase 1 | Advanced solid tumor; Non-hodgkin's lymphoma | [541028], [548516] | |
MK-1496 | Drug Info | Phase 1 | Solid tumours | [522634] | |
NMS-1286937 | Drug Info | Phase 1 | Solid tumours | [522856], [542837] | |
TAK-960 | Drug Info | Phase 1 | Solid tumours | [523131] | |
CYC-800 | Drug Info | Preclinical | Cancer | [547859] | |
DAP-81 | Drug Info | Preclinical | Cancer | [537386] | |
ON 019190.Na | Drug Info | Preclinical | Cancer | [537386] | |
ZK-thiazolidinone | Drug Info | Preclinical | Cancer | [544035] | |
HMN-214 | Drug Info | Discontinued in Phase 1 | Pancreatic cancer; Prostate cancer | [546839] | |
Inhibitor | BI 2536 | Drug Info | [536354], [537386] | ||
CHR-4125 | Drug Info | [543565] | |||
compound 2 | Drug Info | [529878] | |||
CYC-800 | Drug Info | [537386] | |||
DAP-81 | Drug Info | [537386] | |||
GSK461364 | Drug Info | [537386] | |||
GSK579289A | Drug Info | [529981] | |||
GW853606 | Drug Info | [529878] | |||
HMN-214 | Drug Info | [536270], [537386] | |||
LC-445 | Drug Info | [537386] | |||
MK-1496 | Drug Info | [549710] | |||
MLN-0905 | Drug Info | [543565] | |||
NMS-1 | Drug Info | [537386] | |||
ON 019190.Na | Drug Info | [537386] | |||
ZK-thiazolidinone | Drug Info | [536464], [537386] | |||
Modulator | NMS-1286937 | Drug Info | [522856] | ||
Rigosertib | Drug Info | [532659] | |||
TAK-960 | Drug Info | [531743] | |||
Volasertib | Drug Info | [543565] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | FoxO signaling pathway | ||||
Cell cycle | |||||
Oocyte meiosis | |||||
Progesterone-mediated oocyte maturation | |||||
Pathway Interaction Database | p73 transcription factor network | ||||
ATR signaling pathway | |||||
PLK1 signaling events | |||||
FoxO family signaling | |||||
FOXM1 transcription factor network | |||||
Validated transcriptional targets of TAp63 isoforms | |||||
Polo-like kinase signaling events in the cell cycle | |||||
Reactome | Polo-like kinase mediated events | ||||
Golgi Cisternae Pericentriolar Stack Reorganization | |||||
Cdh1 targeted proteins in late mitosis/early G1 | |||||
Phosphorylation of the APC/C | |||||
Phosphorylation of Emi1 | |||||
Condensation of Prophase Chromosomes | |||||
Separation of Sister Chromatids | |||||
Resolution of Sister Chromatid Cohesion | |||||
Regulation of PLK1 Activity at G2/M Transition | |||||
Activation of NIMA Kinases NEK9, NEK6, NEK7 | |||||
Loss of Nlp from mitotic centrosomes | |||||
Recruitment of mitotic centrosome proteins and complexes | |||||
Loss of proteins required for interphase microtubule organization?from the centrosome | |||||
Anchoring of the basal body to the plasma membrane | |||||
RHO GTPases Activate Formins | |||||
Mitotic Prometaphase | |||||
Cyclin A/B1 associated events during G2/M transition | |||||
WikiPathways | Mitotic Telophase/Cytokinesis | ||||
Mitotic Metaphase and Anaphase | |||||
Mitotic Prophase | |||||
Mitotic Prometaphase | |||||
Integrated Pancreatic Cancer Pathway | |||||
TNF alpha Signaling Pathway | |||||
Prostate Cancer | |||||
miR-targeted genes in muscle cell - TarBase | |||||
miR-targeted genes in lymphocytes - TarBase | |||||
miR-targeted genes in epithelium - TarBase | |||||
Integrated Breast Cancer Pathway | |||||
Integrated Cancer pathway | |||||
Mitotic G2-G2/M phases | |||||
Cell Cycle | |||||
APC/C-mediated degradation of cell cycle proteins | |||||
Regulation of toll-like receptor signaling pathway | |||||
References | |||||
Ref 522354 | ClinicalTrials.gov (NCT00701766) BI 2536 Infusional Treatment in Patients Over 60 Years of Age With Refractory or Relapsed Acute Myeloid Leukaemia. U.S. National Institutes of Health. | ||||
Ref 522634 | ClinicalTrials.gov (NCT00880568) Phase I Study of MK-1496 in Patients With Advanced Solid Tumor (MK-1496-002 AM 4)(COMPLETED). U.S. National Institutes of Health. | ||||
Ref 522856 | ClinicalTrials.gov (NCT01014429) Study of NMS-1286937 in Adult Patients With Advanced/Metastatic Solid Tumors. U.S. National Institutes of Health. | ||||
Ref 523131 | ClinicalTrials.gov (NCT01179399) Study of Orally Administered TAK-960 in Patients With Advanced Nonhematologic Malignancies. U.S. National Institutes of Health. | ||||
Ref 524843 | ClinicalTrials.gov (NCT02198482) Trial of Intensive Chemotherapy With or Without Volasertib in Patients With Newly Diagnosed Acute Myeloid Leukemia. U.S. National Institutes of Health. | ||||
Ref 532659 | Phase I study of oral rigosertib (ON 01910.Na), a dual inhibitor of the PI3K and Plk1 pathways, in adult patients with advanced solid malignancies. Clin Cancer Res. 2014 Mar 15;20(6):1656-65. | ||||
Ref 537386 | Polo-like kinase (PLK) inhibitors in preclinical and early clinical development in oncology. Oncologist. 2009 Jun;14(6):559-70. Epub 2009 May 27. | ||||
Ref 541009 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5666). | ||||
Ref 541028 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5684). | ||||
Ref 542777 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7833). | ||||
Ref 542837 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7918). | ||||
Ref 542862 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7947). | ||||
Ref 544035 | Use of the Novel Plk1 Inhibitor ZK-Thiazolidinone to Elucidate Functions of Plk1 in Early and Late Stages of Mitosis. Mol Biol Cell. 2007 October; 18(10): 4024-4036. | ||||
Ref 546839 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010558) | ||||
Ref 522856 | ClinicalTrials.gov (NCT01014429) Study of NMS-1286937 in Adult Patients With Advanced/Metastatic Solid Tumors. U.S. National Institutes of Health. | ||||
Ref 529878 | Discovery of thiophene inhibitors of polo-like kinase. Bioorg Med Chem Lett. 2009 Feb 1;19(3):1018-21. | ||||
Ref 529981 | Design of potent thiophene inhibitors of polo-like kinase 1 with improved solubility and reduced protein binding. Bioorg Med Chem Lett. 2009 Mar 15;19(6):1694-7. | ||||
Ref 531743 | TAK-960, a novel, orally available, selective inhibitor of polo-like kinase 1, shows broad-spectrum preclinical antitumor activity in multiple dosing regimens. Mol Cancer Ther. 2012 Mar;11(3):700-9. | ||||
Ref 532659 | Phase I study of oral rigosertib (ON 01910.Na), a dual inhibitor of the PI3K and Plk1 pathways, in adult patients with advanced solid malignancies. Clin Cancer Res. 2014 Mar 15;20(6):1656-65. | ||||
Ref 536270 | A phase I pharmacokinetic study of HMN-214, a novel oral stilbene derivative with polo-like kinase-1-interacting properties, in patients with advanced solid tumors. Clin Cancer Res. 2006 Sep 1;12(17):5182-9. | ||||
Ref 536354 | BI 2536, a potent and selective inhibitor of polo-like kinase 1, inhibits tumor growth in vivo. Curr Biol. 2007 Feb 20;17(4):316-22. Epub 2007 Feb 8. | ||||
Ref 536464 | Use of the novel Plk1 inhibitor ZK-thiazolidinone to elucidate functions of Plk1 in early and late stages of mitosis. Mol Biol Cell. 2007 Oct;18(10):4024-36. Epub 2007 Aug 1. | ||||
Ref 537386 | Polo-like kinase (PLK) inhibitors in preclinical and early clinical development in oncology. Oncologist. 2009 Jun;14(6):559-70. Epub 2009 May 27. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.