Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T35194
|
||||
| Former ID |
TTDR00085
|
||||
| Target Name |
Dual specificity protein phosphatase 1
|
||||
| Gene Name |
DUSP1
|
||||
| Synonyms |
Dual specificity protein phosphatase hVH1; MAP kinase phosphatase-1; MKP-1; Protein-tyrosine phosphatase CL100; DUSP1
|
||||
| Target Type |
Research
|
||||
| Function |
Dual specificity phosphatase that dephosphorylates MAP kinase MAPK1/ERK2 on both 'Thr-183' and 'Tyr-185', regulating its activity during the meiotic cell cycle.
|
||||
| BioChemical Class |
Phosphoric monoester hydrolases
|
||||
| Target Validation |
T35194
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.1.3.48
|
||||
| Sequence |
MVMEVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAM
GLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFF LKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPF LYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA IDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS FMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSP ITTSPSC |
||||
| Pathways | |||||
| KEGG Pathway | MAPK signaling pathway | ||||
| Serotonergic synapse | |||||
| NetPath Pathway | FSH Signaling Pathway | ||||
| IL2 Signaling Pathway | |||||
| EGFR1 Signaling Pathway | |||||
| Wnt Signaling Pathway | |||||
| TCR Signaling Pathway | |||||
| Pathway Interaction Database | Fc-epsilon receptor I signaling in mast cells | ||||
| Regulation of p38-alpha and p38-beta | |||||
| Direct p53 effectors | |||||
| ErbB1 downstream signaling | |||||
| ATF-2 transcription factor network | |||||
| AP-1 transcription factor network | |||||
| Reactome | RAF-independent MAPK1/3 activation | ||||
| Negative regulation of MAPK pathway | |||||
| WikiPathways | MAPK Signaling Pathway | ||||
| References | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.