Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T31309
|
||||
| Former ID |
TTDC00319
|
||||
| Target Name |
Apoptosis regulator Bcl-2
|
||||
| Gene Name |
BCL2
|
||||
| Synonyms |
Bcl-2; BCL2
|
||||
| Target Type |
Successful
|
||||
| Disease | Advanced melanoma; Multiple myeloma [ICD9: 172, 203.0; ICD10: C43, C90] | ||||
| Amyotrophic lateral sclerosis [ICD9: 335.2; ICD10: G12.2] | |||||
| Advanced small cell lung cancer; Relapsed or refractory chronic lymphocytic leukemia; Lymphoid malignancies [ICD9: 140-229, 140-239, 162, 162.9, 202, 204.0, 204.1, 208.9; ICD10: C33-C34, C34.90, C81-C86, C91-C95, C91.0, C91.1] | |||||
| Breast cancer [ICD9: 174, 175; ICD10: C50] | |||||
| Chronic lymphocytic leukaemia [ICD10: C91] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Psoriasis [ICD9: 696; ICD10: L40] | |||||
| Prostate cancer [ICD9: 185; ICD10: C61] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Unspecified [ICD code not available] | |||||
| Function |
Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1).
|
||||
| BioChemical Class |
Bcl-2 family
|
||||
| Target Validation |
T31309
|
||||
| UniProt ID | |||||
| Sequence |
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | GDC-0199 | Drug Info | Approved | Chronic lymphocytic leukaemia | [889440] |
| MCI-186 | Drug Info | Approved | Amyotrophic lateral sclerosis | [889446] | |
| Oral paclitaxel | Drug Info | Approved | Cancer | [551871] | |
| Taxol | Drug Info | Approved | Breast carcinoma | [530307] | |
| GDC-0199 | Drug Info | Phase 3 | Cancer | [524916], [543069] | |
| Liposomal encapsulated paclitaxel (LEP) | Drug Info | Phase 3 | Cancer | [551035] | |
| Oblimersen | Drug Info | Phase 3 | Advanced melanoma; Multiple myeloma | [521495], [543024] | |
| RG7601 | Drug Info | Phase 3 | Chronic lymphocytic leukaemia | [549281] | |
| Taxol/Paraplatin/Herceptin | Drug Info | Phase 3 | Breast cancer | [528260] | |
| ABT-263 | Drug Info | Phase 2 | Advanced small cell lung cancer; Relapsed or refractory chronic lymphocytic leukemia; Lymphoid malignancies | [543070], [551607] | |
| Gossypol | Drug Info | Phase 2 | Prostate cancer | [467538], [522588] | |
| Obatoclax | Drug Info | Phase 2 | Solid tumours | [531104] | |
| PI-88/Taxotere | Drug Info | Phase 2 | Cancer | [521777] | |
| AI-850 | Drug Info | Phase 1 | Solid tumours | [527516], [530307] | |
| Irofulven/Taxotere | Drug Info | Phase 1 | Cancer | [551729] | |
| Pc4 (topical formulation | Drug Info | Phase 1 | Psoriasis | [526695] | |
| ABT-737 | Drug Info | Terminated | Discovery agent | [543071], [546653] | |
| Inhibitor | 2,3,4-trihydroxy-5-isopropyl-N-phenyl-benzamide | Drug Info | [528469] | ||
| 4,5-dibenzylbenzene-1,2-diol | Drug Info | [530890] | |||
| 5,10-Dioxy-2-phenyl-benzo[g]pteridin-4-ylamine | Drug Info | [526209] | |||
| ABT-263 | Drug Info | [536702], [536883], [551607] | |||
| ABT-737 | Drug Info | [528642] | |||
| Apogossypol | Drug Info | [542839] | |||
| N-phenyl-2,3,4-trihydroxy-5-benzyl-benzamide | Drug Info | [528469] | |||
| Obatoclax | Drug Info | [531104] | |||
| Oblimersen | Drug Info | [537114] | |||
| QEDIIRNIARHLAQVGDSMDR | Drug Info | [528469] | |||
| TW-37 | Drug Info | [528469] | |||
| Modulator | AI-850 | Drug Info | [527516], [530307] | ||
| GDC-0199 | Drug Info | [532178] | |||
| Irofulven/Taxotere | Drug Info | [526976] | |||
| Liposomal encapsulated paclitaxel (LEP) | Drug Info | [526031], [530307] | |||
| modified HA14-1 compounds (cancer), GL Pharmaceuticals | Drug Info | [527372] | |||
| Oral paclitaxel | Drug Info | [526031], [530307] | |||
| PI-88/Taxotere | Drug Info | [530520] | |||
| RG7601 | Drug Info | [532178] | |||
| Taxol | Drug Info | [530307] | |||
| Taxol/Paraplatin/Herceptin | Drug Info | [527947] | |||
| WL-276 | Drug Info | [529510] | |||
| Regulator | Gossypol | Drug Info | [536135] | ||
| Regulator (upregulator) | MCI-186 | Drug Info | [536447] | ||
| Agonist | Pc4 (topical formulation | Drug Info | [526695] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | NF-kappa B signaling pathway | ||||
| HIF-1 signaling pathway | |||||
| Sphingolipid signaling pathway | |||||
| Protein processing in endoplasmic reticulum | |||||
| PI3K-Akt signaling pathway | |||||
| Apoptosis | |||||
| Adrenergic signaling in cardiomyocytes | |||||
| Focal adhesion | |||||
| Neurotrophin signaling pathway | |||||
| Cholinergic synapse | |||||
| Amyotrophic lateral sclerosis (ALS) | |||||
| Toxoplasmosis | |||||
| Tuberculosis | |||||
| Hepatitis B | |||||
| Epstein-Barr virus infection | |||||
| Pathways in cancer | |||||
| MicroRNAs in cancer | |||||
| Colorectal cancer | |||||
| Prostate cancer | |||||
| Small cell lung cancer | |||||
| NetPath Pathway | IL5 Signaling Pathway | ||||
| TCR Signaling Pathway | |||||
| IL2 Signaling Pathway | |||||
| IL3 Signaling Pathway | |||||
| Leptin Signaling Pathway | |||||
| RANKL Signaling Pathway | |||||
| TSLP Signaling Pathway | |||||
| PANTHER Pathway | Apoptosis signaling pathway | ||||
| Oxidative stress response | |||||
| CCKR signaling map ST | |||||
| Pathway Interaction Database | Role of Calcineurin-dependent NFAT signaling in lymphocytes | ||||
| IL2-mediated signaling events | |||||
| IL2 signaling events mediated by PI3K | |||||
| Ceramide signaling pathway | |||||
| Direct p53 effectors | |||||
| RXR and RAR heterodimerization with other nuclear receptor | |||||
| ATF-2 transcription factor network | |||||
| C-MYB transcription factor network | |||||
| Negative effector of Fas and TNF-alpha | |||||
| Caspase Cascade in Apoptosis | |||||
| Signaling events mediated by Stem cell factor receptor (c-Kit) | |||||
| EPO signaling pathway | |||||
| IL2 signaling events mediated by STAT5 | |||||
| Validated targets of C-MYC transcriptional repression | |||||
| Reactome | Activation of BAD and translocation to mitochondria | ||||
| BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members | |||||
| The NLRP1 inflammasome | |||||
| WikiPathways | DNA Damage Response (only ATM dependent) | ||||
| Senescence and Autophagy in Cancer | |||||
| IL-2 Signaling Pathway | |||||
| FAS pathway and Stress induction of HSP regulation | |||||
| Focal Adhesion | |||||
| Kit receptor signaling pathway | |||||
| IL-3 Signaling Pathway | |||||
| Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways | |||||
| Apoptosis | |||||
| Nanoparticle triggered autophagic cell death | |||||
| Amyotrophic lateral sclerosis (ALS) | |||||
| Integrated Pancreatic Cancer Pathway | |||||
| Corticotropin-releasing hormone | |||||
| Interleukin-11 Signaling Pathway | |||||
| Prostate Cancer | |||||
| miR-targeted genes in muscle cell - TarBase | |||||
| miR-targeted genes in lymphocytes - TarBase | |||||
| miR-targeted genes in leukocytes - TarBase | |||||
| Integrated Breast Cancer Pathway | |||||
| Integrated Cancer pathway | |||||
| Intrinsic Pathway for Apoptosis | |||||
| Apoptosis Modulation and Signaling | |||||
| TP53 Network | |||||
| Influenza A virus infection | |||||
| IL-5 Signaling Pathway | |||||
| References | |||||
| Ref 467538 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4204). | ||||
| Ref 521495 | ClinicalTrials.gov (NCT00024440) Fludarabine and Cyclophosphamide With or Without Oblimersen in Treating Patients With Relapsed or Refractory Chronic Lymphocytic Leukemia. U.S. National Institutes ofHealth. | ||||
| Ref 521777 | ClinicalTrials.gov (NCT00268593) Pilot Efficacy Study of PI-88 With Docetaxel to Treat Prostate Cancer. U.S. National Institutes of Health. | ||||
| Ref 522588 | ClinicalTrials.gov (NCT00848016) Gossypol Acetic Acid in Treating Patients With Recurrent, Metastatic, or Primary Adrenocortical Cancer That Cannot Be Removed By Surgery. U.S. National Institutes of Health. | ||||
| Ref 524916 | ClinicalTrials.gov (NCT02242942) A Study to Compare the Efficacy and Safety of Obinutuzumab + GDC-0199 Versus Obinutuzumab + Chlorambucil in Patients With Chronic Lymphocytic Leukemia. U.S. National Institutes of Health. | ||||
| Ref 526695 | Association between the photodynamic loss of Bcl-2 and the sensitivity to apoptosis caused by phthalocyanine photodynamic therapy. Photochem Photobiol. 2003 Jul;78(1):1-8. | ||||
| Ref 527516 | Pharm Res. 2005 Mar;22(3):347-55.Intravenous hydrophobic drug delivery: a porous particle formulation of paclitaxel (AI-850). | ||||
| Ref 528260 | Randomized phase III study of trastuzumab, paclitaxel, and carboplatin compared with trastuzumab and paclitaxel in women with HER-2-overexpressing metastatic breast cancer. J Clin Oncol. 2006 Jun 20;24(18):2786-92. | ||||
| Ref 530307 | Paclitaxel directly binds to Bcl-2 and functionally mimics activity of Nur77. Cancer Res. 2009 Sep 1;69(17):6906-14. | ||||
| Ref 531104 | Phase II study of obatoclax mesylate (GX15-070), a small-molecule BCL-2 family antagonist, for patients with myelofibrosis. Clin Lymphoma Myeloma Leuk. 2010 Aug;10(4):285-9. | ||||
| Ref 543024 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8269). | ||||
| Ref 543069 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8318). | ||||
| Ref 543070 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8319). | ||||
| Ref 543071 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8320). | ||||
| Ref 546653 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009496) | ||||
| Ref 549281 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034622) | ||||
| Ref 551729 | MGI PHARMA Initiates Drug Combination Trial of Irofulven and Taxotere in Patients With Advanced Cancers; Phase 1 Dose-Escalating Trial to Evaluate Novel Combination Therapy. 2001 Business Wire | ||||
| Ref 551871 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
| Ref 526031 | The binding conformation of Taxol in beta-tubulin: a model based on electron crystallographic density. Proc Natl Acad Sci U S A. 2001 Apr 24;98(9):5312-6. Epub 2001 Apr 17. | ||||
| Ref 526209 | J Med Chem. 2001 Dec 6;44(25):4313-24.Discovery of small-molecule inhibitors of Bcl-2 through structure-based computer screening. | ||||
| Ref 526695 | Association between the photodynamic loss of Bcl-2 and the sensitivity to apoptosis caused by phthalocyanine photodynamic therapy. Photochem Photobiol. 2003 Jul;78(1):1-8. | ||||
| Ref 526976 | Antitumor activity of irofulven monotherapy and in combination with mitoxantrone or docetaxel against human prostate cancer models. Prostate. 2004 Apr 1;59(1):22-32. | ||||
| Ref 527372 | The small-molecule Bcl-2 inhibitor HA14-1 interacts synergistically with flavopiridol to induce mitochondrial injury and apoptosis in human myeloma cells through a free radical-dependent and Jun NH2-terminal kinase-dependent mechanism. Mol Cancer Ther. 2004 Dec;3(12):1513-24. | ||||
| Ref 527516 | Pharm Res. 2005 Mar;22(3):347-55.Intravenous hydrophobic drug delivery: a porous particle formulation of paclitaxel (AI-850). | ||||
| Ref 527947 | Two concurrent phase II trials of paclitaxel/carboplatin/trastuzumab (weekly or every-3-week schedule) as first-line therapy in women with HER2-overexpressing metastatic breast cancer: NCCTG study 983252. Clin Breast Cancer. 2005 Dec;6(5):425-32. | ||||
| Ref 528469 | J Med Chem. 2006 Oct 19;49(21):6139-42.Structure-based design of potent small-molecule inhibitors of anti-apoptotic Bcl-2 proteins. | ||||
| Ref 528642 | J Med Chem. 2007 Feb 22;50(4):641-62. Epub 2007 Jan 26.Studies leading to potent, dual inhibitors of Bcl-2 and Bcl-xL. | ||||
| Ref 529510 | WL-276, an antagonist against Bcl-2 proteins, overcomes drug resistance and suppresses prostate tumor growth. Cancer Res. 2008 Jun 1;68(11):4377-83. | ||||
| Ref 530307 | Paclitaxel directly binds to Bcl-2 and functionally mimics activity of Nur77. Cancer Res. 2009 Sep 1;69(17):6906-14. | ||||
| Ref 530520 | Multicentre phase I/II study of PI-88, a heparanase inhibitor in combination with docetaxel in patients with metastatic castrate-resistant prostate cancer. Ann Oncol. 2010 Jun;21(6):1302-7. | ||||
| Ref 530890 | J Med Chem. 2010 May 27;53(10):3899-906.Vaccinia virus virulence factor N1L is a novel promising target for antiviral therapeutic intervention. | ||||
| Ref 531104 | Phase II study of obatoclax mesylate (GX15-070), a small-molecule BCL-2 family antagonist, for patients with myelofibrosis. Clin Lymphoma Myeloma Leuk. 2010 Aug;10(4):285-9. | ||||
| Ref 532178 | ABT-199, a potent and selective BCL-2 inhibitor, achieves antitumor activity while sparing platelets. Nat Med. 2013 Feb;19(2):202-8. | ||||
| Ref 536135 | Opportunities and challenges in antiparasitic drug discovery. Nat Rev Drug Discov. 2005 Sep;4(9):727-40. | ||||
| Ref 536447 | Emerging disease-modifying therapies for the treatment of motor neuron disease/amyotropic lateral sclerosis. Expert Opin Emerg Drugs. 2007 May;12(2):229-52. | ||||
| Ref 536702 | ABT-263: a potent and orally bioavailable Bcl-2 family inhibitor. Cancer Res. 2008 May 1;68(9):3421-8. | ||||
| Ref 536883 | ABT-263 and rapamycin act cooperatively to kill lymphoma cells in vitro and in vivo. Mol Cancer Ther. 2008 Oct;7(10):3265-74. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.