Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T28226
|
||||
| Former ID |
TTDR00115
|
||||
| Target Name |
GTP cyclohydrolase I
|
||||
| Gene Name |
GCH1
|
||||
| Synonyms |
GTP-CH-I; Guanosine triphosphate cyclohydrolase I; GCH1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Parkinson's disease [ICD9: 332; ICD10: G20] | ||||
| Function |
Isoform gch-1 is the functional enzyme, the potential function of the enzymatically inactive isoforms remains unknown.
|
||||
| BioChemical Class |
Carbon-nitrogen hydrolase
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.5.4.16
|
||||
| Sequence |
MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRS
EEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDA IFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQ VQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKT REEFLTLIRS |
||||
| Structure |
1FB1
|
||||
| Drugs and Mode of Action | |||||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| PathWhiz Pathway | Pterine Biosynthesis | ||||
| Reactome | Tetrahydrobiopterin (BH4) synthesis, recycling, salvage and regulation | ||||
| References | |||||
| Ref 467793 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4556). | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.