Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T25703
|
||||
| Former ID |
TTDC00134
|
||||
| Target Name |
Heme oxygenase
|
||||
| Gene Name |
HMOX1
|
||||
| Synonyms |
HO-1; Heme Oxygenase-1; HMOX1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Neonatal hyperbilirubinemia; Jaundice [ICD9: 773, 774, 782.4; ICD10: P58, P59, R17] | ||||
| Function |
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.
|
||||
| BioChemical Class |
Oxidoreductases acting on paired donors
|
||||
| Target Validation |
T25703
|
||||
| UniProt ID | |||||
| EC Number |
EC 1.14.99.3
|
||||
| Sequence |
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVA
LEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHE VGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQ LYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRA SNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM |
||||
| Structure |
1N3U; 1N45; 1NI6; 1OYK; 1OYL; 1OZE; 1OZL; 1OZR; 1OZW; 1S13; 1S8C; 1T5P; 1TWN; 1TWR; 1XJZ; 1XK0; 1XK1; 1XK2; 1XK3; 3CZY; 3HOK; 3K4F; 3TGM
|
||||
| Drugs and Mode of Action | |||||
| Inhibitor | 1-(adamantan-1-yl)-2-(1H-imidazol-1-yl)ethanone | Drug Info | [551374] | ||
| 12-Phenylheme | Drug Info | [551393] | |||
| 2-Phenylheme | Drug Info | [551393] | |||
| 2-Propanol, Isopropanol | Drug Info | [551393] | |||
| Biliverdine Ix Alpha | Drug Info | [551393] | |||
| Formic Acid | Drug Info | [551393] | |||
| Heme | Drug Info | [551374] | |||
| Stannsoporfin | Drug Info | [536043] | |||
| Tin protoporphyrin | Drug Info | [535305] | |||
| Verdoheme | Drug Info | [551391] | |||
| Pathways | |||||
| BioCyc Pathway | Heme degradation | ||||
| KEGG Pathway | Porphyrin and chlorophyll metabolism | ||||
| HIF-1 signaling pathway | |||||
| Mineral absorption | |||||
| MicroRNAs in cancer | |||||
| Pathway Interaction Database | Validated transcriptional targets of AP1 family members Fra1 and Fra2 | ||||
| HIF-1-alpha transcription factor network | |||||
| PathWhiz Pathway | Porphyrin Metabolism | ||||
| Reactome | Iron uptake and transport | ||||
| WikiPathways | Oxidative Stress | ||||
| Transcriptional activation by NRF2 | |||||
| NRF2 pathway | |||||
| Nuclear Receptors Meta-Pathway | |||||
| miR-targeted genes in squamous cell - TarBase | |||||
| miR-targeted genes in muscle cell - TarBase | |||||
| miR-targeted genes in lymphocytes - TarBase | |||||
| miR-targeted genes in leukocytes - TarBase | |||||
| miR-targeted genes in epithelium - TarBase | |||||
| References | |||||
| Ref 535305 | Adenovirus-mediated heme oxygenase-1 gene delivery inhibits injury-induced vascular neointima formation. Circulation. 2001 Nov 27;104(22):2710-5. | ||||
| Ref 536043 | Chemoprevention of severe neonatal hyperbilirubinemia. Semin Perinatol. 2004 Oct;28(5):365-8. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.