Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T24634
|
||||
| Former ID |
TTDS00233
|
||||
| Target Name |
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
|
||||
| Gene Name |
murA
|
||||
| Synonyms |
EPT; Enoylpyruvate transferase; MurA; MurA protein; UDP-GlcNAcenolpyruvyl transferase; UDP-N-acetylglucosamine enolpyruvyl transferase; murA
|
||||
| Target Type |
Successful
|
||||
| Disease | Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | ||||
| Gram-positive bacterial infection [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104] | |||||
| Function |
Cell wall formation. Adds enolpyruvyl to UDP-n- acetylglucosamine. Target for the antibiotic phosphomycin.
|
||||
| BioChemical Class |
Alkyl aryl transferase
|
||||
| Target Validation |
T24634
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.5.1.7
|
||||
| Sequence |
MDKFRVQGPTKLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDVDTSMKLLSQL
GAKVERNGSVHIDARDVNVFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCTIGAR PVDLHISGLEQLGATIKLEEGYVKASVDGRLKGAHIVMDKVSVGATVTIMCAATLAEGTT IIENAAREPEIVDTANFLITLGAKISGQGTDRIVIEGVERLGGGVYRVLPDRIETGTFLV AAAISRGKIICRNAQPDTLDAVLAKLRDAGADIEVGEDWISLDMHGKRPKAVNVRTAPHP AFPTDMQAQFTLLNLVAEGTGFITETVFENRFMHVPELSRMGAHAEIESNTVICHGVEKL SGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRALGANIERVKGE |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | 1-Anilino-8-Naphthalene Sulfonate | Drug Info | [551393] | ||
| Aminomethylcyclohexane | Drug Info | [551393] | |||
| CNICIN | Drug Info | [528414] | |||
| Cyclohexylammonium Ion | Drug Info | [551393] | |||
| CYNAROPICRIN | Drug Info | [528414] | |||
| EUPATORIOPICRIN | Drug Info | [528414] | |||
| Fosfomycin | Drug Info | [534914], [535690], [535949], [536015] | |||
| L-Iso-Aspartate | Drug Info | [551393] | |||
| RWJ-140998 | Drug Info | [536094] | |||
| RWJ-3981 | Drug Info | [536094] | |||
| Uridine-Diphosphate-N-Acetylglucosamine | Drug Info | [551391] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| DRM | DRM Info | ||||
| References | |||||
| Ref 528414 | Bioorg Med Chem Lett. 2006 Nov 1;16(21):5605-9. Epub 2006 Aug 30.Sesquiterpene lactones are potent and irreversible inhibitors of the antibacterial target enzyme MurA. | ||||
| Ref 534914 | Lysine 22 in UDP-N-acetylglucosamine enolpyruvyl transferase from Enterobacter cloacae is crucial for enzymatic activity and the formation of covalent adducts with the substrate phosphoenolpyruvate and the antibiotic fosfomycin. Biochemistry. 1999 Oct 5;38(40):13162-9. | ||||
| Ref 535690 | In vitro and in vivo functional activity of Chlamydia MurA, a UDP-N-acetylglucosamine enolpyruvyl transferase involved in peptidoglycan synthesis and fosfomycin resistance. J Bacteriol. 2003 Feb;185(4):1218-28. | ||||
| Ref 535949 | Conditional lethal amber mutations in essential Escherichia coli genes. J Bacteriol. 2004 May;186(9):2673-81. | ||||
| Ref 536015 | Evidence that the fosfomycin target Cys115 in UDP-N-acetylglucosamine enolpyruvyl transferase (MurA) is essential for product release. J Biol Chem. 2005 Feb 4;280(5):3757-63. Epub 2004 Nov 5. | ||||
| Ref 536094 | Emerging drugs for bacterial urinary tract infections. Expert Opin Emerg Drugs. 2005 May;10(2):275-98. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.