Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T22956
|
||||
| Former ID |
TTDI02041
|
||||
| Target Name |
Cyclin-dependent kinase-3
|
||||
| Gene Name |
CDK3
|
||||
| Synonyms |
Cell division protein kinase 3; Cyclindependent kinase 3; CDK3
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Hematological malignancies [ICD9: 200-209; ICD10: C81-C86] | ||||
| Function |
Serine/threonine-protein kinase that plays a critical role in the control of the eukaryotic cell cycle; involved in G0- G1 and G1-S cell cycle transitions. Interacts with CCNC/cyclin-C during interphase. Phosphorylates histone H1, ATF1, RB1 and CABLES1. ATF1 phosphorylation triggers ATF1 transactivation and transcriptional activities, and promotes cell proliferation and transformation. CDK3/cyclin-C mediated RB1 phosphorylation is required for G0-G1 transition. Promotes G1-S transition probably by contributing to the activation of E2F1, E2F2 and E2F3 in a RB1- independent manner.
|
||||
| BioChemical Class |
Kinase
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.11.22
|
||||
| Sequence |
MDMFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKH
PNIVRLLDVVHNERKLYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHS HRVIHRDLKPQNLLINELGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFY TTAVDIWSIGCIFAEMVTRKALFPGDSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSF PKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVL QRFRH |
||||
| Drugs and Mode of Action | |||||
| References | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.