Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T21507
|
||||
| Former ID |
TTDR00309
|
||||
| Target Name |
Fatty acid-bindingprotein, epidermal
|
||||
| Gene Name |
FABP5
|
||||
| Synonyms |
E-FABP; Fatty Acid BindingProtein mal1; PA-FABP; Psoriasis-associated fatty acid-binding protein homolog; FABP5
|
||||
| Target Type |
Research
|
||||
| Function |
High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation.
|
||||
| BioChemical Class |
Fatty acid bindingprotein
|
||||
| Target Validation |
T21507
|
||||
| UniProt ID | |||||
| Sequence |
MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTL
KTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVEC VMNNVTCTRIYEKVE |
||||
| Pathways | |||||
| KEGG Pathway | PPAR signaling pathway | ||||
| NetPath Pathway | IL1 Signaling Pathway | ||||
| Reactome | Hormone-sensitive lipase (HSL)-mediated triacylglycerol hydrolysis | ||||
| References | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.