Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T19160
|
||||
Former ID |
TTDC00025
|
||||
Target Name |
Phospholipase A2, membrane associated
|
||||
Gene Name |
PLA2G2A
|
||||
Synonyms |
GIIC sPLA2; Group IIA phospholipase A2; NPS-PLA2; Non-pancreatic secretory phospholipase A2; PLA2B; PLA2L; Phosphatidylcholine 2-acylhydrolase; RASF-A; PLA2G2A
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Breast cancer [ICD9: 174, 175; ICD10: C50] | ||||
Function |
Thoughtto participate in the regulation of the phospholipid metabolism in biomembranes including eicosanoid biosynthesis. Catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides.
|
||||
BioChemical Class |
Carboxylic ester hydrolase
|
||||
Target Validation |
T19160
|
||||
UniProt ID | |||||
EC Number |
EC 3.1.1.4
|
||||
Sequence |
MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDAT
DRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFAR NKTTYNKKYQYYSNKHCRGSTPRC |
||||
Drugs and Mode of Action | |||||
Inhibitor | 1,4-Butanediol | Drug Info | [551398] | ||
2-(4-phenoxyphenoxy)ethanamine | Drug Info | [529868] | |||
B-Octylglucoside | Drug Info | [551393] | |||
BOLINAQUINONE | Drug Info | [526069] | |||
CACOSPONGIONOLIDE | Drug Info | [534672] | |||
CACOSPONGIONOLIDE B | Drug Info | [534672] | |||
Cacospongionolide E | Drug Info | [534672] | |||
DIDODECANOYLPHLOROGLUCINOL | Drug Info | [529718] | |||
DYSIDINE | Drug Info | [526069] | |||
Elaidoylamide | Drug Info | [551393] | |||
Isopropyl Alcohol | Drug Info | [551374] | |||
KH064 | Drug Info | [526563] | |||
Lauric Acid | Drug Info | [551393] | |||
LUFFARIELLOLIDE | Drug Info | [551354] | |||
N-Tridecanoic Acid | Drug Info | [551374] | |||
OCHNAFLAVONE | Drug Info | [528052] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
BioCyc Pathway | Phospholipases | ||||
KEGG Pathway | Glycerophospholipid metabolism | ||||
Ether lipid metabolism | |||||
Arachidonic acid metabolism | |||||
Linoleic acid metabolism | |||||
alpha-Linolenic acid metabolism | |||||
Metabolic pathways | |||||
Ras signaling pathway | |||||
Vascular smooth muscle contraction | |||||
Pancreatic secretion | |||||
Fat digestion and absorption | |||||
Pathway Interaction Database | Glypican 1 network | ||||
Reactome | Acyl chain remodelling of PC | ||||
Acyl chain remodelling of PE | |||||
Acyl chain remodelling of PI | |||||
WikiPathways | Cardiac Hypertrophic Response | ||||
Glycerophospholipid biosynthesis | |||||
Glycerophospholipid Biosynthetic Pathway | |||||
Spinal Cord Injury | |||||
Eicosanoid Synthesis | |||||
MicroRNAs in cardiomyocyte hypertrophy | |||||
References | |||||
Ref 526069 | J Nat Prod. 2001 May;64(5):612-5.New sesquiterpene derivatives from the sponge Dysidea species with a selective inhibitor profile against human phospholipase A2 and other leukocyte functions. | ||||
Ref 526563 | D-Tyrosine as a chiral precusor to potent inhibitors of human nonpancreatic secretory phospholipase A2 (IIa) with antiinflammatory activity. Chembiochem. 2003 Mar 3;4(2-3):181-5. | ||||
Ref 528052 | Bioorg Med Chem Lett. 2006 May 1;16(9):2373-5. Epub 2006 Feb 28.Synthesis of phospholipase A2 inhibitory biflavonoids. | ||||
Ref 529718 | Bioorg Med Chem Lett. 2008 Oct 15;18(20):5415-9. Epub 2008 Sep 12.Simplified YM-26734 inhibitors of secreted phospholipase A2 group IIA. | ||||
Ref 529868 | J Med Chem. 2008 Dec 25;51(24):7882-8.Discovery of multitarget inhibitors by combining molecular docking with common pharmacophore matching. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.