Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T12817
|
||||
| Former ID |
TTDS00234
|
||||
| Target Name |
73-kDa molecular chaperone HSP73
|
||||
| Gene Name |
HSPA8
|
||||
| Synonyms |
HSP73; Heat shock protein 73; HSPA8
|
||||
| Target Type |
Research
|
||||
| Function |
Acts as a repressor of transcriptional activation. Inhibits the transcriptional coactivator activity of CITED1 on Smad-mediated transcription. Chaperone. Component of the PRP19- CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. May have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex. Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes. Participates in the ER-associated degradation (ERAD) quality control pathway in conjunction with J domain-containing co-chaperones and the E3 ligase CHIP.
|
||||
| BioChemical Class |
Heat shock protein
|
||||
| Target Validation |
T12817
|
||||
| UniProt ID | |||||
| Sequence |
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD |
||||
| Pathways | |||||
| KEGG Pathway | Spliceosome | ||||
| MAPK signaling pathway | |||||
| Protein processing in endoplasmic reticulum | |||||
| Endocytosis | |||||
| Antigen processing and presentation | |||||
| Estrogen signaling pathway | |||||
| Legionellosis | |||||
| Toxoplasmosis | |||||
| Measles | |||||
| Influenza A | |||||
| Epstein-Barr virus infection | |||||
| NetPath Pathway | TCR Signaling Pathway | ||||
| TSH Signaling Pathway | |||||
| IL4 Signaling Pathway | |||||
| PANTHER Pathway | Apoptosis signaling pathway | ||||
| Parkinson disease | |||||
| Pathway Interaction Database | Regulation of nuclear SMAD2/3 signaling | ||||
| C-MYB transcription factor network | |||||
| Reactome | Regulation of HSF1-mediated heat shock response | ||||
| Attenuation phase | |||||
| HSF1-dependent transactivation | |||||
| Lysosome Vesicle Biogenesis | |||||
| Golgi Associated Vesicle Biogenesis | |||||
| CHL1 interactions | |||||
| mRNA Splicing - Major Pathway | |||||
| WikiPathways | Diurnally Regulated Genes with Circadian Orthologs | ||||
| MAPK Signaling Pathway | |||||
| Regulation of mRNA Stability by Proteins that Bind AU-rich Elements | |||||
| GABA synthesis, release, reuptake and degradation | |||||
| Parkin-Ubiquitin Proteasomal System pathway | |||||
| Membrane Trafficking | |||||
| L1CAM interactions | |||||
| References | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.