Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T00176
|
||||
Former ID |
TTDC00206
|
||||
Target Name |
Ubiquitin-protein ligase E3 Mdm2
|
||||
Gene Name |
MDM2
|
||||
Synonyms |
Double minute 2 protein; Hdm2; MDM2 protein; Oncoprotein Mdm2; P53-binding protein Mdm2; MDM2
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Acute myeloid leukemia [ICD9: 205; ICD10: C92.0] | ||||
Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
Hematological malignancies [ICD9: 200-209; ICD10: C81-C86] | |||||
Non-small cell lung cancer; Prostate cancer [ICD9:185; ICD10: C33-C34, C61] | |||||
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
Function |
Inhibits p53- and p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Functions as a ubiquitin ligase e3, in the presence of e1 and e2, toward p53 and itself. Permits the nuclear export ofp53 and targets it.
|
||||
BioChemical Class |
Carbon-nitrogen ligase
|
||||
Target Validation |
T00176
|
||||
UniProt ID | |||||
EC Number |
EC 6.3.2.-
|
||||
Sequence |
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT SVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQ RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLA DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVP DCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQ DKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ PIQMIVLTYFP |
||||
Drugs and Mode of Action | |||||
Drug(s) | AMG 232 | Drug Info | Phase 1/2 | Cancer | [524711] |
DS-3032 | Drug Info | Phase 1 | Solid tumours | [524327] | |
JNJ-26854165 | Drug Info | Phase 1 | Non-small cell lung cancer; Prostate cancer | [522321] | |
RG7388 | Drug Info | Phase 1 | Hematological malignancies | [525138] | |
RG7775 | Drug Info | Phase 1 | Acute myeloid leukemia | [549548] | |
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | FoxO signaling pathway | ||||
Cell cycle | |||||
p53 signaling pathway | |||||
Ubiquitin mediated proteolysis | |||||
Endocytosis | |||||
PI3K-Akt signaling pathway | |||||
Thyroid hormone signaling pathway | |||||
Epstein-Barr virus infection | |||||
Pathways in cancer | |||||
Transcriptional misregulation in cancer | |||||
Viral carcinogenesis | |||||
Proteoglycans in cancer | |||||
MicroRNAs in cancer | |||||
Glioma | |||||
Prostate cancer | |||||
Melanoma | |||||
Bladder cancer | |||||
Chronic myeloid leukemia | |||||
PANTHER Pathway | Insulin/IGF pathway-protein kinase B signaling cascade | ||||
p53 pathway | |||||
Ubiquitin proteasome pathway | |||||
P53 pathway feedback loops 1 | |||||
p53 pathway feedback loops 2 | |||||
Pathway Interaction Database | ErbB4 signaling events | ||||
p73 transcription factor network | |||||
ATR signaling pathway | |||||
ATM pathway | |||||
Glucocorticoid receptor regulatory network | |||||
Sumoylation by RanBP2 regulates transcriptional repression | |||||
Direct p53 effectors | |||||
Regulation of Androgen receptor activity | |||||
Validated transcriptional targets of deltaNp63 isoforms | |||||
Aurora A signaling | |||||
Validated transcriptional targets of TAp63 isoforms | |||||
p53 pathway | |||||
Regulation of retinoblastoma protein | |||||
Reactome | AKT phosphorylates targets in the cytosol | ||||
Oxidative Stress Induced Senescence | |||||
Oncogene Induced Senescence | |||||
Trafficking of AMPA receptors | |||||
Constitutive Signaling by AKT1 E17K in Cancer | |||||
Stabilization of p53 | |||||
WikiPathways | DNA Damage Response (only ATM dependent) | ||||
DNA Damage Response | |||||
ErbB Signaling Pathway | |||||
Senescence and Autophagy in Cancer | |||||
Tryptophan metabolism | |||||
G1 to S cell cycle control | |||||
Copper homeostasis | |||||
Bladder Cancer | |||||
Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell | |||||
PIP3 activates AKT signaling | |||||
Apoptosis | |||||
ATM Signaling Pathway | |||||
Retinoblastoma (RB) in Cancer | |||||
Integrated Pancreatic Cancer Pathway | |||||
Prostate Cancer | |||||
Signaling Pathways in Glioblastoma | |||||
Integrated Breast Cancer Pathway | |||||
Integrated Cancer pathway | |||||
Cell Cycle | |||||
Cell Cycle Checkpoints | |||||
TP53 Network | |||||
miRNA Regulation of DNA Damage Response | |||||
Androgen receptor signaling pathway | |||||
References | |||||
Ref 522321 | ClinicalTrials.gov (NCT00676910) A Research Study of JNJ-26854165 to Determine the Safety and Dose in Patients With Advanced Stage or Refractory Solid Tumors.. U.S. National Institutes of Health. | ||||
Ref 524327 | ClinicalTrials.gov (NCT01877382) A Phase 1 Multiple Ascending Dose Study of DS-3032b, an Oral Murine Double Minute 2 (MDM2) Inhibitor, in Subjects With Advanced Solid Tumors or Lymphomas. U.S. National Institutes of Health. | ||||
Ref 524711 | ClinicalTrials.gov (NCT02110355) A Phase 1b/2a Study Evaluating AMG 232 in Metastatic Melanoma. U.S. National Institutes of Health. | ||||
Ref 525403 | Drugging the p53 pathway: understanding the route to clinical efficacy. Nat Rev Drug Discov. 2014 Mar;13(3):217-36. doi: 10.1038/nrd4236. | ||||
Ref 532478 | Serdemetan antagonizes the Mdm2-HIF1alpha axis leading to decreased levels of glycolytic enzymes. PLoS One. 2013 Sep 6;8(9):e74741. | ||||
Ref 532858 | Discovery of a small molecule MDM2 inhibitor (AMG 232) for treating cancer. J Med Chem. 2014 Aug 14;57(15):6332-41. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.