Target General Infomation
Target ID
T07217
Former ID
TTDR00476
Target Name
Fatty acid-binding protein, adipocyte
Gene Name
FABP4
Synonyms
A-FABP; AFABP; ALBP; AP2; Adipocyte fatty binding protein; Adipocyte fatty-acid-binding protein; Adipocyte lipid-binding protein; FABP4
Target Type
Research
Function
Lipid transport protein in adipocytes. Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus (By similarity).
BioChemical Class
Calycin family
Target Validation
T07217
UniProt ID
Sequence
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
Inhibitor 1-benzyl-2,3-dimethyl-1H-indole-7-carboxylic acid Drug Info [529963]
2-(2,3-bis(2-chlorobenzyloxy)phenyl)acetic acid Drug Info [528353]
2-(3-Methyl-indole-1-sulfonyl)-benzoic acid Drug Info [527208]
2-(4-Fluoro-indole-1-sulfonyl)-benzoic acid Drug Info [527208]
2-(4-Methyl-indole-1-sulfonyl)-benzoic acid Drug Info [527208]
2-(5-Bromo-indole-1-sulfonyl)-benzoic acid Drug Info [527208]
2-(6-Methoxy-indole-1-sulfonyl)-benzoic acid Drug Info [527208]
2-(Carbazole-9-sulfonyl)-benzoic acid Drug Info [527208]
3-Carbazol-9-yl-propionic acid Drug Info [527208]
4-Carbazol-9-yl-butyric acid Drug Info [527208]
5-Carbazol-9-yl-pentanoic acid Drug Info [527208]
BMS-480404 Drug Info [528353]
Hexadecanoic acid Drug Info [527208]
LINOLEIC ACID Drug Info [530916]
OLEIC ACID Drug Info [530916]
Pathways
KEGG Pathway PPAR signaling pathway
NetPath Pathway TCR Signaling Pathway
Pathway Interaction Database AP-1 transcription factor network
Reactome Hormone-sensitive lipase (HSL)-mediated triacylglycerol hydrolysis
Transcriptional regulation of white adipocyte differentiation
WikiPathways Lipid digestion, mobilization, and transport
Transcriptional Regulation of White Adipocyte Differentiation
References
Ref 527208Bioorg Med Chem Lett. 2004 Sep 6;14(17):4445-8.Discovery of inhibitors of human adipocyte fatty acid-binding protein, a potential type 2 diabetes target.
Ref 528353J Med Chem. 2006 Aug 10;49(16):5013-7.NMR structure of a potent small molecule inhibitor bound to human keratinocyte fatty acid-binding protein.
Ref 529963Bioorg Med Chem Lett. 2009 Mar 15;19(6):1745-8. Epub 2009 Jan 30.N-Benzyl-indolo carboxylic acids: Design and synthesis of potent and selective adipocyte fatty-acid binding protein (A-FABP) inhibitors.
Ref 530916Bioorg Med Chem Lett. 2010 Jun 15;20(12):3675-9. Epub 2010 Apr 24.Discovery of highly selective inhibitors of human fatty acid binding protein 4 (FABP4) by virtual screening.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.