Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T88126
|
||||
| Former ID |
TTDR00348
|
||||
| Target Name |
Nicotinate-nucleotide adenylyltransferase
|
||||
| Gene Name |
nadD
|
||||
| Synonyms |
Deamido-NAD(+) diphosphorylase; Deamido-NAD(+) pyrophosphorylase; Deamido-NAD(+)Nicotinate-nucleotide adenylyltransferase pyrophosphorylase; NaMN adenylyltransferase; Nicotinate mononucleotide adenylyltransferase; nadD
|
||||
| Target Type |
Research
|
||||
| Function |
Catalyzes the reversible adenylation of nicotinate mononucleotide (namn) to nicotinic acid adenine dinucleotide (naad).
|
||||
| BioChemical Class |
Kinase
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.7.18
|
||||
| Sequence |
MKSLQALFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPEANSVQRKHML
ELAIADKPLFTLDERELKRNAPSYTAQTLKEWRQEQGPDVPLAFIIGQDSLLTFPTWYEY ETILDNAHLIVCRRPGYPLEMAQPQYQQWLEDHLTHNPEDLHLQPAGKIYLAETPWFNIS ATIIRERLQNGESCEDLLPEPVLTYINQQGLYR |
||||
| References | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.