Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T34743
|
||||
| Former ID |
TTDS00213
|
||||
| Target Name |
DNA
|
||||
| Gene Name |
dacA
|
||||
| Synonyms |
Penicillin binding protein; dacA
|
||||
| Target Type |
Successful
|
||||
| Disease | Acute lymphoblastic leukemia [ICD9: 204.0, 556; ICD10: C91.0] | ||||
| Acute myeloid leukemia [ICD9: 205; ICD10: C92.0] | |||||
| Arthritis [ICD9: 710-719; ICD10: M00-M25] | |||||
| Acute bronchitis [ICD10: J20-J21, J42] | |||||
| Brain cancer; Glioma [ICD9:191, 225.0; ICD10: C71, D33] | |||||
| Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | |||||
| Brain cancer [ICD9: 191, 225.0; ICD10: C71, D33] | |||||
| Breast cancer [ICD9: 174, 175; ICD10: C50] | |||||
| Chronic bronchitis [ICD10: J42] | |||||
| Cystic fibrosis [ICD9: 277; ICD10: E84] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Chronic lymphocytic leukaemia [ICD10: C91] | |||||
| Dietary shortage [ICD9: 260-269; ICD10: E40-E46] | |||||
| Fungal infections [ICD9: 110-118; ICD10: B35-B49] | |||||
| Gram-positive bacterial infection [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104] | |||||
| Gastrointestinal cancers; Breast cancers [ICD9: 150-159, 174, 175; ICD10: C15-C26, C50] | |||||
| Hodgkin's lymphoma [ICD10: C81] | |||||
| Herpes simplex virus infection [ICD9: 54; ICD10: B00] | |||||
| Infections by susceptible microorganisms [ICD10: A00-B99] | |||||
| Infections of the upper and lower urinary tract [ICD10: A00-B99] | |||||
| Leukemia [ICD9: 208.9; ICD10: C90-C95] | |||||
| Lupus nephritis [ICD9: 583.81; ICD10: M32.1, N08.5] | |||||
| Malaria [ICD10: B54] | |||||
| Myelodysplastic syndrome; Acute lymphoblastic leukemia [ICD9:238.7, 204.0, 556; ICD10: D46, C91.0] | |||||
| Metastatic islet cell carcinoma [ICD9: 157.4; ICD10: C25.4] | |||||
| Melanoma [ICD9: 172; ICD10: C43] | |||||
| Neurological disease [ICD9: 338, 338.2, 410, 782.3,780; ICD10: I21, I22, R52, R52.1-R52.2, R60.9, G89] | |||||
| Ovarian cancer [ICD9: 183; ICD10: C56] | |||||
| Psoriasis; Cutaneous T-cell lymphoma [ICD9:696, 202.1, 202.2; ICD10: L40, C84.0, C84.1] | |||||
| Pseudomonas aeruginosa infection; Haemophilus influenzae infection [ICD10: B96.5] | |||||
| Refractory chronic myeloid leukaemia [ICD9: 205.1; ICD10: C92.1] | |||||
| Systemic lupus erythematosus [ICD9: 710; ICD10: M32] | |||||
| Sepsis [ICD9: 995.91; ICD10: A40, A41] | |||||
| Stage IA/IB mycosisfungoides-type cutaneous T-cell lymphoma [ICD10: C81-C86] | |||||
| Urinary tract infections [ICD9: 599; ICD10: N39.0] | |||||
| Target Validation |
T34743
|
||||
| UniProt ID | |||||
| Sequence |
MNTIFSARIMKRLALTTALCTAFISAAHADDLNIKTMIPGVPQIDAESYILIDYNSGKVL
AEQNADVRRDPASLTKMMTSYVIGQAMKAGKFKETDLVTIGNDAWATGNPVFKGSSLMFL KPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMNSYVNALGLKNTHFQTVH GLDADGQYSSARDMALIGQALIRDVPNEYSIYKEKEFTFNGIRQLNRNGLLWDNSLNVDG IKTGHTDKAGYNLVASATEGQMRLISAVMGGRTFKGREAESKKLLTWGFRFFETVNPLKV GKEFASEPVWFGDSDRASLGVDKDVYLTIPRGRMKDLKASYVLNSSELHAPLQKNQVVGT INFQLDGKTIEQRPLVVLQEIPEGNFFGKIIDYIKLMFHHWFG |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Adenine | Drug Info | Approved | Dietary shortage | [468017], [550673] |
| Altretamine | Drug Info | Approved | Ovarian cancer | [538535], [542119] | |
| Ampicillin | Drug Info | Approved | Bacterial infections | [538200] | |
| Azlocillin | Drug Info | Approved | Pseudomonas aeruginosa infection; Haemophilus influenzae infection | [551871] | |
| Bacampicillin | Drug Info | Approved | Bacterial infections | [538600] | |
| Balofloxacin | Drug Info | Approved | Gram-positive bacterial infection | [536094] | |
| Bleomycin | Drug Info | Approved | Hodgkin's lymphoma | [536361] | |
| Carbenicillin | Drug Info | Approved | Infections of the upper and lower urinary tract | [551871] | |
| Cefacetrile | Drug Info | Approved | Bacterial infections | [550676] | |
| Cefaclor | Drug Info | Approved | Bacterial infections | [538203] | |
| Cefadroxil | Drug Info | Approved | Bacterial infections | [468064], [538205] | |
| Cefamandole | Drug Info | Approved | Infections by susceptible microorganisms | [551871] | |
| Cefazolin | Drug Info | Approved | Bacterial infections | [538217] | |
| Cefdinir | Drug Info | Approved | Bacterial infections | [536222] | |
| Cefditoren | Drug Info | Approved | Bacterial infections | [536361] | |
| Cefixime | Drug Info | Approved | Bacterial infections | [536361] | |
| Cefonicid | Drug Info | Approved | Bacterial infections | [536361] | |
| Cefoperazone | Drug Info | Approved | Bacterial infections | [536361] | |
| Ceforanide | Drug Info | Approved | Bacterial infections | [536361] | |
| Cefotetan | Drug Info | Approved | Bacterial infections | [536361] | |
| Cefoxitin | Drug Info | Approved | Bacterial infections | [536361] | |
| Cefpiramide | Drug Info | Approved | Bacterial infections | [536361] | |
| Cefpodoxime | Drug Info | Approved | Bacterial infections | [536361] | |
| Cefprozil | Drug Info | Approved | Bacterial infections | [536361] | |
| Cefradine | Drug Info | Approved | Bacterial infections | [468063], [544499] | |
| Ceftazidime | Drug Info | Approved | Bacterial infections | [536361] | |
| Ceftibuten | Drug Info | Approved | Chronic bronchitis | [551871] | |
| Ceftizoxime | Drug Info | Approved | Bacterial infections | [536361] | |
| Cefuroxime | Drug Info | Approved | Acute bronchitis | [551871] | |
| Cephalexin | Drug Info | Approved | Bacterial infections | [468065], [538201] | |
| Cephapirin | Drug Info | Approved | Sepsis | [538207], [551871] | |
| Chlorambucil | Drug Info | Approved | Chronic lymphocytic leukaemia | [538433], [542151] | |
| Ciprofloxacin XR | Drug Info | Approved | Gram-positive bacterial infection | [536094] | |
| Clofarabine | Drug Info | Approved | Myelodysplastic syndrome; Acute lymphoblastic leukemia | [527466], [536361], [541885], [551871] | |
| Cloxacillin | Drug Info | Approved | Bacterial infections | [538198] | |
| Cyclacillin | Drug Info | Approved | Bacterial infections | [468048], [538209], [551871] | |
| Dacarbazine | Drug Info | Approved | Melanoma | [538295] | |
| Dactinomycin | Drug Info | Approved | Cancer | [538603] | |
| Dicloxacillin | Drug Info | Approved | Bacterial infections | [538204] | |
| Dornase Alfa | Drug Info | Approved | Cystic fibrosis | [536361] | |
| Elliptinium acetate | Drug Info | Approved | Cancer | [551871] | |
| Ertapenem | Drug Info | Approved | Bacterial infections | [536361] | |
| Flucloxacillin | Drug Info | Approved | Bacterial infections | [550700] | |
| Idoxuridine | Drug Info | Approved | Herpes simplex virus infection | [538467] | |
| Lomustine | Drug Info | Approved | Brain cancer; Glioma | [538491], [542229], [551871] | |
| Loracarbef | Drug Info | Approved | Bacterial infections | [536361] | |
| Mechlorethamine | Drug Info | Approved | Stage IA/IB mycosisfungoides-type cutaneous T-cell lymphoma | [551871] | |
| Mercaptopurine | Drug Info | Approved | Acute lymphoblastic leukemia | [537297], [542241] | |
| Methoxsalen | Drug Info | Approved | Psoriasis; Cutaneous T-cell lymphoma | [538412], [551871] | |
| Methylene blue | Drug Info | Approved | Acquired methemoglobinemia | [538085] | |
| Meticillin | Drug Info | Approved | Bacterial infections | [550731] | |
| Mitomycin | Drug Info | Approved | Gastrointestinal cancers; Breast cancers | [536361], [542094] | |
| Mitomycin A | Drug Info | Approved | Cancer | [536361] | |
| Mitomycin C | Drug Info | Approved | Cancer | [536361] | |
| Nafcillin | Drug Info | Approved | Arthritis | [538206], [551871] | |
| Nelarabine | Drug Info | Approved | Leukemia | [536361], [536644], [542096], [551186] | |
| Neocarzinostatin | Drug Info | Approved | Cancer | [551871] | |
| Nitrofurantoin | Drug Info | Approved | Urinary tract infections | [538414] | |
| Oxacillin | Drug Info | Approved | Bacterial infections | [538199] | |
| Penicillin V | Drug Info | Approved | Bacterial infections | [536773] | |
| Piperacillin | Drug Info | Approved | Bacterial infections | [536823] | |
| Pipobroman | Drug Info | Approved | Refractory chronic myeloid leukaemia | [538475], [542291], [551871] | |
| Pirarubicin | Drug Info | Approved | Breast cancer | [524155], [551871] | |
| Pivampicillin | Drug Info | Approved | Bacterial infections | [550745] | |
| Pivmecillinam | Drug Info | Approved | Urinary tract infections | [550761], [551871] | |
| Primaquine | Drug Info | Approved | Malaria | [538406] | |
| Procarbazine | Drug Info | Approved | Hodgkin's lymphoma | [538480], [542298] | |
| Proflavine | Drug Info | Approved | Sepsis | [550748] | |
| Streptozocin | Drug Info | Approved | Metastatic islet cell carcinoma | [536361] | |
| Thioguanine | Drug Info | Approved | Acute myeloid leukemia | [536361], [541925] | |
| Ticarcillin | Drug Info | Approved | Bacterial infections | [538597] | |
| Uracil mustard | Drug Info | Approved | Acute myeloid leukemia | [536361], [542609], [551871] | |
| Zinostatin stimalamer | Drug Info | Approved | Brain cancer | [551871] | |
| Mechlorethamine | Drug Info | Phase 3 | Hodgkin's lymphoma | [542232], [551871] | |
| Indol-3-carbinol | Drug Info | Preclinical | Fungal infections | [537364] | |
| Abetimus sodium | Drug Info | Discontinued in Phase 3 | Lupus nephritis | [536055] | |
| TV-4710 | Drug Info | Discontinued in Phase 2 | Systemic lupus erythematosus | [536055] | |
| Talisomycin | Drug Info | Terminated | Discovery agent | [544740] | |
| Meticillin | Drug Info | Investigative | Neurological disease | [525919] | |
| Inhibitor | 2-(3,4-Dihydroxyphenyl)Acetic Acid | Drug Info | [551393] | ||
| Abetimus sodium | Drug Info | [536055] | |||
| Balofloxacin | Drug Info | [536094] | |||
| Beta-D-Glucose | Drug Info | [551393] | |||
| Ciprofloxacin XR | Drug Info | [536094] | |||
| Lipid Fragment | Drug Info | [551393] | |||
| Lomustine | Drug Info | [536461] | |||
| Phosphomethylphosphonic Acid Adenosyl Ester | Drug Info | [551393] | |||
| Thiamin Diphosphate | Drug Info | [551393] | |||
| TV-4710 | Drug Info | [536055] | |||
| Intercalator | Actinomycin D | Drug Info | [535170] | ||
| Adriamycin | Drug Info | [537817] | |||
| Ametantrone | Drug Info | [537764] | |||
| Chlorambucil | Drug Info | [537444] | |||
| Daunomycin | Drug Info | [537682] | |||
| Ethidium | Drug Info | [537682] | |||
| Mechlorethamine | Drug Info | [537392] | |||
| Nogalamycin | Drug Info | [534880] | |||
| Thioguanine | Drug Info | [537106] | |||
| Binder | Adenine | Drug Info | [536215], [537584] | ||
| Ampicillin | Drug Info | [535430] | |||
| Azlocillin | Drug Info | [537684] | |||
| Bacampicillin | Drug Info | [536284] | |||
| Carbenicillin | Drug Info | [537657] | |||
| Cefacetrile | Drug Info | [536792] | |||
| Cefaclor | Drug Info | [536052] | |||
| Cefadroxil | Drug Info | [538061] | |||
| Cefamandole | Drug Info | [538071] | |||
| Cefazolin | Drug Info | [536598] | |||
| Cefdinir | Drug Info | [536431] | |||
| Cefditoren | Drug Info | [536486] | |||
| Cefixime | Drug Info | [537473] | |||
| Cefonicid | Drug Info | [537802] | |||
| Cefoperazone | Drug Info | [538144] | |||
| Ceforanide | Drug Info | [535771] | |||
| Cefotetan | Drug Info | [536418] | |||
| Cefoxitin | Drug Info | [536821] | |||
| Cefpiramide | Drug Info | [536284] | |||
| Cefpodoxime | Drug Info | [536267] | |||
| Cefprozil | Drug Info | [536099] | |||
| Cefradine | Drug Info | [536821] | |||
| Ceftazidime | Drug Info | [536645] | |||
| Ceftibuten | Drug Info | [537479] | |||
| Ceftizoxime | Drug Info | [536047] | |||
| Cefuroxime | Drug Info | [535705] | |||
| Cephalexin | Drug Info | [535908] | |||
| Cephapirin | Drug Info | [537909] | |||
| Clofarabine | Drug Info | [536496] | |||
| Cloxacillin | Drug Info | [536385] | |||
| Cyclacillin | Drug Info | [536284] | |||
| Dicloxacillin | Drug Info | [537799] | |||
| Ertapenem | Drug Info | [536047] | |||
| Flucloxacillin | Drug Info | [537799] | |||
| Idoxuridine | Drug Info | [534878] | |||
| Indol-3-carbinol | Drug Info | [537364] | |||
| Loracarbef | Drug Info | [536267] | |||
| Methoxsalen | Drug Info | [537800] | |||
| Meticillin | Drug Info | [536269] | |||
| Mitomycin | Drug Info | [537608] | |||
| Nafcillin | Drug Info | [537679] | |||
| Nelarabine | Drug Info | [536644] | |||
| Oxacillin | Drug Info | [537307] | |||
| Penicillin V | Drug Info | [537832] | |||
| Piperacillin | Drug Info | [536021] | |||
| Pipobroman | Drug Info | [537776] | |||
| Pivampicillin | Drug Info | [536284] | |||
| Pivmecillinam | Drug Info | [536997] | |||
| Proflavine | Drug Info | [537222] | |||
| Ticarcillin | Drug Info | [537929] | |||
| Breaker | Altretamine | Drug Info | [536640] | ||
| Bleomycin | Drug Info | [537784] | |||
| Dacarbazine | Drug Info | [537543] | |||
| Dactinomycin | Drug Info | [534930] | |||
| Dornase Alfa | Drug Info | [536538] | |||
| Duocarmycin | Drug Info | [534930] | |||
| Enediyne antibiotics | Drug Info | [534930] | |||
| Mercaptopurine | Drug Info | [537146] | |||
| Nitracrine | Drug Info | [534871] | |||
| Nitrofurantoin | Drug Info | [537957] | |||
| Streptozocin | Drug Info | [537542] | |||
| Talisomycin | Drug Info | [537784] | |||
| Binder (minor groove binder) | Bisbenzimide (Hoechst 33258) | Drug Info | [537830] | ||
| Di-imidazole lexitropsin | Drug Info | [538053] | |||
| Distamycin A | Drug Info | [535333] | |||
| Netropsin | Drug Info | [537664] | |||
| Modulator | Elliptinium acetate | Drug Info | [527631], [534365], [536361] | ||
| Neocarzinostatin | Drug Info | [536361] | |||
| Pirarubicin | Drug Info | [536361] | |||
| Uracil mustard | Drug Info | [537960] | |||
| Zinostatin stimalamer | Drug Info | [536361] | |||
| References | |||||
| Ref 468017 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4788). | ||||
| Ref 468048 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4817). | ||||
| Ref 468063 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4830). | ||||
| Ref 468064 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4831). | ||||
| Ref 468065 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4832). | ||||
| Ref 524155 | ClinicalTrials.gov (NCT01746992) CTOP/ITE/MTX Compared With CHOP as the First-line Therapy for Newly Diagnosed Young Patients With T Cell Lymphoma. U.S. National Institutes of Health. | ||||
| Ref 536055 | Emergence of targeted immune therapies for systemic lupus. Expert Opin Emerg Drugs. 2005 Feb;10(1):53-65. | ||||
| Ref 536094 | Emerging drugs for bacterial urinary tract infections. Expert Opin Emerg Drugs. 2005 May;10(2):275-98. | ||||
| Ref 536222 | Emerging therapies for the treatment and prevention of otitis media. Expert Opin Emerg Drugs. 2006 May;11(2):251-64. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 536773 | How many modes of action should an antibiotic have? Curr Opin Pharmacol. 2008 Oct;8(5):564-73. Epub 2008 Jul 30. | ||||
| Ref 536823 | Zosyn (piperacillin/tazobactam) reformulation: Expanded compatibility and coadministration with lactated Ringer's solutions and selected aminoglycosides. Ther Clin Risk Manag. 2008 Apr;4(2):303-14. | ||||
| Ref 537297 | S-adenosylmethionine regulates thiopurine methyltransferase activity and decreases 6-mercaptopurine cytotoxicity in MOLT lymphoblasts. Biochem Pharmacol. 2009 Jun 15;77(12):1845-53. Epub 2009 Mar 19. | ||||
| Ref 537364 | Novel antifungal agents, targets or therapeutic strategies for the treatment of invasive fungal diseases: a review of the literature (2005-2009). Rev Iberoam Micol. 2009 Mar 31;26(1):15-22. Epub 2009 May 7. | ||||
| Ref 538085 | Recombinant Plasmodium falciparum glutathione reductase is inhibited by the antimalarial dye methylene blue. FEBS Lett. 1998 Feb 6;422(3):311-4. | ||||
| Ref 538198 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 061454. | ||||
| Ref 538199 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 061490. | ||||
| Ref 538200 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 061936. | ||||
| Ref 538201 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 061969. | ||||
| Ref 538203 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 062206. | ||||
| Ref 538204 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 062286. | ||||
| Ref 538205 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 062291. | ||||
| Ref 538206 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 062527. | ||||
| Ref 538207 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 062720. | ||||
| Ref 538209 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 062895. | ||||
| Ref 538217 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 065244. | ||||
| Ref 538295 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 075259. | ||||
| Ref 538406 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 008316. | ||||
| Ref 538412 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 009048. | ||||
| Ref 538414 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 009175. | ||||
| Ref 538433 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 010669. | ||||
| Ref 538467 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 014169. | ||||
| Ref 538475 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016245. | ||||
| Ref 538480 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016785. | ||||
| Ref 538491 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 017588. | ||||
| Ref 538535 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 019926. | ||||
| Ref 538597 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 050497. | ||||
| Ref 538600 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 050520. | ||||
| Ref 538603 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 050682. | ||||
| Ref 541885 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6802). | ||||
| Ref 541925 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6845). | ||||
| Ref 542094 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7089). | ||||
| Ref 542096 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7090). | ||||
| Ref 542119 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7112). | ||||
| Ref 542151 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7143). | ||||
| Ref 542229 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7214). | ||||
| Ref 542232 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7218). | ||||
| Ref 542241 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7226). | ||||
| Ref 542291 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7271). | ||||
| Ref 542298 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7278). | ||||
| Ref 542609 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7621). | ||||
| Ref 544499 | Textbook of Therapeutics: Drug and Disease Management. 2006, P892. By Richard A. Helms, Eric T. Herfindal, David J. Quan, Dick R. Gourley. | ||||
| Ref 534365 | Stationary potential of the brain: Part II. Clinical studies. Neurol Med Chir (Tokyo). 1979 Jul;19(7):655-64. | ||||
| Ref 534871 | Crosslinking of cellular DNA by nitracrine and furocoumarin derivatives. Neoplasma. 1999;46(1):50-3. | ||||
| Ref 534878 | Radiopharmaceuticals (Strontium 89) and radiosensitizers (idoxuridine). J Intraven Nurs. 1998 Nov-Dec;21(6):335-7. | ||||
| Ref 534880 | Structure, dynamics and hydration of the nogalamycin-d(ATGCAT)2Complex determined by NMR and molecular dynamics simulations in solution. J Mol Biol. 1999 Jul 16;290(3):699-716. | ||||
| Ref 534930 | Structural studies of atom-specific anticancer drugs acting on DNA. Pharmacol Ther. 1999 Sep;83(3):181-215. | ||||
| Ref 535170 | Crystallographic analysis of a novel complex of actinomycin D bound to the DNA decamer CGATCGATCG. Biochemistry. 2001 May 15;40(19):5587-92. | ||||
| Ref 535232 | Selective activation of mitomycin A by thiols to form DNA cross-links and monoadducts: biochemical basis for the modulation of mitomycin cytotoxicity by the quinone redox potential. J Med Chem. 2001 Aug 16;44(17):2834-42. | ||||
| Ref 535333 | Development of distamycin-related DNA binding anticancer drugs. Expert Opin Investig Drugs. 2001 Sep;10(9):1703-14. | ||||
| Ref 535430 | Effects of amino acid alterations in penicillin-binding proteins (PBPs) 1a, 2b, and 2x on PBP affinities of penicillin, ampicillin, amoxicillin, cefditoren, cefuroxime, cefprozil, and cefaclor in 18 clinical isolates of penicillin-susceptible, -intermediate, and -resistant pneumococci. Antimicrob Agents Chemother. 2002 May;46(5):1273-80. | ||||
| Ref 535705 | Cefuroxime resistance in non-beta-lactamase Haemophilus influenzae is linked to mutations in ftsI. J Antimicrob Chemother. 2003 Mar;51(3):523-30. | ||||
| Ref 535771 | The pharmacokinetics of the interstitial space in humans. BMC Clin Pharmacol. 2003 Jul 30;3:3. | ||||
| Ref 535908 | Relationship between penicillin-binding protein patterns and beta-lactamases in clinical isolates of Bacteroides fragilis with different susceptibility to beta-lactam antibiotics. J Med Microbiol. 2004 Mar;53(Pt 3):213-21. | ||||
| Ref 536021 | In vitro antienterococcal activity explains associations between exposures to antimicrobial agents and risk of colonization by multiresistant enterococci. J Infect Dis. 2004 Dec 15;190(12):2162-6. Epub 2004 Nov 16. | ||||
| Ref 536047 | Role of penicillin-binding protein 2 (PBP2) in the antibiotic susceptibility and cell wall cross-linking of Staphylococcus aureus: evidence for the cooperative functioning of PBP2, PBP4, and PBP2A. JBacteriol. 2005 Mar;187(5):1815-24. | ||||
| Ref 536052 | Antibacterial activity of oral cephems against various clinically isolated strains and evaluation of efficacy based on the pharmacokinetics/pharmacodynamics theory. Jpn J Antibiot. 2004 Dec;57(6):465-74. | ||||
| Ref 536055 | Emergence of targeted immune therapies for systemic lupus. Expert Opin Emerg Drugs. 2005 Feb;10(1):53-65. | ||||
| Ref 536094 | Emerging drugs for bacterial urinary tract infections. Expert Opin Emerg Drugs. 2005 May;10(2):275-98. | ||||
| Ref 536099 | Microbiology and antimicrobial management of sinusitis. J Laryngol Otol. 2005 Apr;119(4):251-8. | ||||
| Ref 536215 | Leishmania donovani singly deficient in HGPRT, APRT or XPRT are viable in vitro and within mammalian macrophages. Mol Biochem Parasitol. 2006 Jul;148(1):24-30. Epub 2006 Mar 15. | ||||
| Ref 536267 | Amino acid substitutions in mosaic penicillin-binding protein 2 associated with reduced susceptibility to cefixime in clinical isolates of Neisseria gonorrhoeae. Antimicrob Agents Chemother. 2006 Nov;50(11):3638-45. Epub 2006 Aug 28. | ||||
| Ref 536269 | A link in transcription between the native pbpB and the acquired mecA gene in a strain of Staphylococcus aureus. Microbiology. 2006 Sep;152(Pt 9):2549-58. | ||||
| Ref 536284 | Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 536385 | Development of a receptor-based microplate assay for the detection of beta-lactam antibiotics in different food matrices. Anal Chim Acta. 2007 Mar 14;586(1-2):296-303. Epub 2006 Sep 26. | ||||
| Ref 536418 | In-vitro profile of a new beta-lactam, ceftobiprole, with activity against methicillin-resistant Staphylococcus aureus. Clin Microbiol Infect. 2007 Jun;13 Suppl 2:17-24. | ||||
| Ref 536431 | Decreased affinity of mosaic-structure recombinant penicillin-binding protein 2 for oral cephalosporins in Neisseria gonorrhoeae. J Antimicrob Chemother. 2007 Jul;60(1):54-60. Epub 2007 May 31. | ||||
| Ref 536461 | Synthesis and evaluation of ethylnitrosoureas of substituted naphthalimides as anticancer compounds. Acta Pol Pharm. 2007 Jan-Feb;64(1):27-33. | ||||
| Ref 536470 | Primaquine-induced differential gene expression analysis in mice liver using DNA microarrays. Toxicology. 2007 Sep 24;239(1-2):96-107. Epub 2007 Jul 1. | ||||
| Ref 536486 | Crystal structure of cefditoren complexed with Streptococcus pneumoniae penicillin-binding protein 2X: structural basis for its high antimicrobial activity. Antimicrob Agents Chemother. 2007 Nov;51(11):3902-7. Epub 2007 Aug 27. | ||||
| Ref 536598 | Bacteriological characteristics of Staphylococcus aureus isolates from humans and bulk milk. J Dairy Sci. 2008 Feb;91(2):564-9. | ||||
| Ref 536640 | Synergy of irofulven in combination with other DNA damaging agents: synergistic interaction with altretamine, alkylating, and platinum-derived agents in the MV522 lung tumor model. Cancer Chemother Pharmacol. 2008 Dec;63(1):19-26. Epub 2008 Feb 28. | ||||
| Ref 536645 | New and emerging treatment of Staphylococcus aureus infections in the hospital setting. Clin Microbiol Infect. 2008 Apr;14 Suppl 3:32-41. | ||||
| Ref 536792 | Single dose 1 g ceftriaxone for urogenital and pharyngeal infection caused by Neisseria gonorrhoeae. Int J Urol. 2008 Sep;15(9):837-42. Epub 2008 Jul 25. | ||||
| Ref 536821 | Staphylococcus aureus PBP4 is essential for beta-lactam resistance in community-acquired methicillin-resistant strains. Antimicrob Agents Chemother. 2008 Nov;52(11):3955-66. Epub 2008 Aug 25. | ||||
| Ref 536874 | Brca2/Xrcc2 dependent HR, but not NHEJ, is required for protection against O(6)-methylguanine triggered apoptosis, DSBs and chromosomal aberrations by a process leading to SCEs. DNA Repair (Amst). 2009 Jan 1;8(1):72-86. Epub 2008 Oct 21. | ||||
| Ref 536997 | Association between antimicrobial consumption and resistance in Escherichia coli. Antimicrob Agents Chemother. 2009 Mar;53(3):912-7. Epub 2008 Dec 22. | ||||
| Ref 537036 | Naphthyridinomycin-DNA adducts: a molecular modeling study. J Antibiot (Tokyo). 1991 Aug;44(8):885-94. | ||||
| Ref 537106 | Immune effector cells produce lethal DNA damage in cells treated with a thiopurine. Cancer Res. 2009 Mar 15;69(6):2393-9. Epub 2009 Feb 24. | ||||
| Ref 537146 | 6-mercaptopurine (6-MP) induces p53-mediated apoptosis of neural progenitor cells in the developing fetal rodent brain. Neurotoxicol Teratol. 2009 Jul-Aug;31(4):198-202. Epub 2009 Mar 10. | ||||
| Ref 537222 | Interaction of small molecules with double-stranded RNA: spectroscopic, viscometric, and calorimetric study of hoechst and proflavine binding to PolyCG structures. DNA Cell Biol. 2009 Apr;28(4):209-19. | ||||
| Ref 537307 | Novel anion liposome-encapsulated antisense oligonucleotide restores susceptibility of methicillin-resistant Staphylococcus aureus and rescues mice from lethal sepsis by targeting mecA. Antimicrob Agents Chemother. 2009 Jul;53(7):2871-8. Epub 2009 May 11. | ||||
| Ref 537364 | Novel antifungal agents, targets or therapeutic strategies for the treatment of invasive fungal diseases: a review of the literature (2005-2009). Rev Iberoam Micol. 2009 Mar 31;26(1):15-22. Epub 2009 May 7. | ||||
| Ref 537392 | Proteomic analysis of DNA-protein cross-linking by antitumor nitrogen mustards. Chem Res Toxicol. 2009 Jun;22(6):1151-62. | ||||
| Ref 537444 | Roles of DNA repair and reductase activity in the cytotoxicity of the hypoxia-activated dinitrobenzamide mustard PR-104A. Mol Cancer Ther. 2009 Jun;8(6):1714-23. Epub 2009 Jun 9. | ||||
| Ref 537473 | Genetics of chromosomally mediated intermediate resistance to ceftriaxone and cefixime in Neisseria gonorrhoeae. Antimicrob Agents Chemother. 2009 Jun 15. | ||||
| Ref 537479 | Neisseria gonorrhoeae and emerging resistance to extended spectrum cephalosporins. Curr Opin Infect Dis. 2009 Feb;22(1):87-91. | ||||
| Ref 537542 | Hydrodynamics-based Transfection of Pancreatic Duodenal Homeobox 1 DNA Improves Hyperglycemia and is Associated with Limited Complications in Diabetic mice. Endocr J. 2009 Jun 27. | ||||
| Ref 537543 | Predicting the myelotoxicity of chemotherapy: the use of pretreatment O6-methylguanine-DNA methyltransferase determination in peripheral blood mononuclear cells. Melanoma Res. 2009 Jun 25. | ||||
| Ref 537544 | Photoluminescence of CdTe nanocrystals modulated by methylene blue and DNA. A label-free luminescent signaling nanohybrid platform. Phys Chem Chem Phys. 2009 Jul 7;11(25):5062-9. Epub 2009 Mar 26. | ||||
| Ref 537584 | E.coli DNA Adenine Methyltransferase: Intra-Site Processivity and Substrate-Induced Dimerization and Activation. Biochemistry. 2009 Jul 6. | ||||
| Ref 537608 | Assessment of cell viability, lipid peroxidation and quantification of DNA fragmentation after the treatment of anticancerous drug mitomycin C and curcumin in cultured human blood lymphocytes. Exp Toxicol Pathol. 2009 Jul 14. | ||||
| Ref 537657 | Resistance of Pseudomonas aeruginosa to cefsulodin: modification of penicillin-binding protein 3 and mapping of its chromosomal gene. J Antimicrob Chemother. 1990 Apr;25(4):513-23. | ||||
| Ref 537664 | Drug-DNA binding specificity: binding of netropsin and distamycin to poly(d2NH2A-dT). Biopolymers. 1990;30(1-2):223-7. | ||||
| Ref 537679 | Binding affinity for penicillin-binding protein 2a correlates with in vivo activity of beta-lactam antibiotics against methicillin-resistant Staphylococcus aureus. J Infect Dis. 1990 Sep;162(3):705-10. | ||||
| Ref 537682 | 31P NMR spectra of ethidium, quinacrine, and daunomycin complexes with poly(adenylic acid).poly(uridylic acid) RNA duplex and calf thymus DNA. Biochemistry. 1989 Apr 4;28(7):2804-12. | ||||
| Ref 537684 | Reactivation of peptidoglycan synthesis in ether-permeabilized Escherichia coli after inhibition by beta-lactam antibiotics. Antimicrob Agents Chemother. 1989 Dec;33(12):2101-8. | ||||
| Ref 537764 | Interactions of antitumor agents Ametantrone and Mitoxantrone (Novatrone) with double-stranded DNA. Biochem Pharmacol. 1985 Dec 15;34(24):4203-13. | ||||
| Ref 537776 | Effects of piposulfan (Ancyte) on protein and DNA synthesis in Ehrlich ascites carcinoma. Life Sci II. 1971 Jun 8;10(11):605-12. | ||||
| Ref 537784 | Bleomycin and talisomycin sequence-specific strand scission of DNA: a mechanism of double-strand cleavage. Cancer Res. 1982 Jul;42(7):2779-85. | ||||
| Ref 537799 | Mechanisms of resistance to beta-lactam antibiotics in Staphylococcus aureus. Scand J Infect Dis Suppl. 1984;42:64-71. | ||||
| Ref 537800 | Mutagenicity and carcinogenicity of methoxsalen plus UV-A. Arch Dermatol. 1984 May;120(5):662-9. | ||||
| Ref 537802 | Affinity of cefonicid, a long-acting cephalosporin, for the penicillin-binding proteins of Escherichia coli K-12. J Antibiot (Tokyo). 1984 May;37(5):572-6. | ||||
| Ref 537817 | Interaction of adriamycin with DNA as studied by resonance Raman spectroscopy. Nucleic Acids Res. 1982 Jun 25;10(12):3803-16. | ||||
| Ref 537830 | Sequence-dependent effects in drug-DNA interaction: the crystal structure of Hoechst 33258 bound to the d(CGCAAATTTGCG)2 duplex. Nucleic Acids Res. 1994 May 11;22(9):1607-12. | ||||
| Ref 537832 | Localization of penicillin-binding proteins to the splitting system of Staphylococcus aureus septa by using a mercury-penicillin V derivative. J Bacteriol. 1995 Jul;177(13):3631-40. | ||||
| Ref 537898 | Crystal structure of a covalent DNA-drug adduct: anthramycin bound to C-C-A-A-C-G-T-T-G-G and a molecular explanation of specificity. Biochemistry. 1994 Nov 22;33(46):13593-610. | ||||
| Ref 537909 | The formation of functional penicillin-binding proteins. J Biol Chem. 1975 Aug 25;250(16):6578-85. | ||||
| Ref 537929 | Activities of antibiotics against methicillin-resistant Staphylococcus aureus with particular reference to synergetic effect between ticarcillin and fosfomycin on penicillinase non-producing methicillin-resistant S. aureus. Jpn J Antibiot. 1993 Jun;46(6):421-7. | ||||
| Ref 537957 | On the nature of the adaptive response induced by mitomycin C in Vibrio cholerae OGAWA 154 cells. Biochem Biophys Res Commun. 1996 Mar 27;220(3):509-14. | ||||
| Ref 537960 | Excision of DNA adducts of nitrogen mustards by bacterial and mammalian 3-methyladenine-DNA glycosylases. Carcinogenesis. 1996 Apr;17(4):643-8. | ||||
| Ref 538053 | Defining GC-specificity in the minor groove: side-by-side binding of the di-imidazole lexitropsin to C-A-T-G-G-C-C-A-T-G. Structure. 1997 Aug 15;5(8):1033-46. | ||||
| Ref 538061 | Penicillin-binding protein sensitive to cephalexin in sporulation of Bacillus cereus. Microbiol Res. 1997 Sep;152(3):227-32. | ||||
| Ref 538071 | The impact of penicillinase on cefamandole treatment and prophylaxis of experimental endocarditis due to methicillin-resistant Staphylococcus aureus. J Infect Dis. 1998 Jan;177(1):146-54. | ||||
| Ref 538101 | DNA interactions of a novel platinum drug, cis-[PtCl(NH3)2(N7-acyclovir)]+. Mol Pharmacol. 1998 May;53(5):846-55. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.