Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T85616
|
||||
Former ID |
TTDC00075
|
||||
Target Name |
Thioredoxin
|
||||
Gene Name |
TXN
|
||||
Synonyms |
ADF; ATL-derived factor; SASP; Surface associated sulphydryl protein; TXN
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
Function |
ADF augments the expression of the interleukin-2 receptor TAC (IL2R/P55).
|
||||
BioChemical Class |
Thioredoxin
|
||||
Target Validation |
T85616
|
||||
UniProt ID | |||||
Sequence |
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD
DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV |
||||
Drugs and Mode of Action | |||||
Pathways | |||||
NetPath Pathway | IL2 Signaling Pathway | ||||
RANKL Signaling Pathway | |||||
PANTHER Pathway | Hypoxia response via HIF activation | ||||
Oxidative stress response | |||||
Pathway Interaction Database | p38 MAPK signaling pathway | ||||
Signaling events mediated by PTP1B | |||||
TNF receptor signaling pathway | |||||
PathWhiz Pathway | Purine Metabolism | ||||
Reactome | Oxidative Stress Induced Senescence | ||||
Detoxification of Reactive Oxygen Species | |||||
TP53 Regulates Metabolic Genes | |||||
The NLRP3 inflammasome | |||||
WikiPathways | NRF2 pathway | ||||
Nuclear Receptors Meta-Pathway | |||||
Detoxification of Reactive Oxygen Species | |||||
Human Complement System | |||||
Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways | |||||
TNF alpha Signaling Pathway | |||||
Metabolism of nucleotides | |||||
Selenium Micronutrient Network | |||||
References | |||||
Ref 536388 | A Phase I pharmacokinetic and pharmacodynamic study of PX-12, a novel inhibitor of thioredoxin-1, in patients with advanced solid tumors. Clin Cancer Res. 2007 Apr 1;13(7):2109-14. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.