Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T80070
|
||||
| Former ID |
TTDR00618
|
||||
| Target Name |
Hypoxanthine-guanine-xanthine phosphoribosyltransferase
|
||||
| Gene Name |
LACZ
|
||||
| Synonyms |
HGPRT; HGXPRT; HGXPRTase; LACZ
|
||||
| Target Type |
Research
|
||||
| Function |
Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5- phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Works with guanine, hypoxanthine and xanthine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway (By similarity).
|
||||
| BioChemical Class |
Pentosyltransferase
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.4.2.-
|
||||
| Sequence |
MPIPNNPGAGENAFDPVFVKDDDGYDLDSFMIPAHYKKYLTKVLVPNGVIKNRIEKLAYD
IKKVYNNEEFHILCLLKGSRGFFTALLKHLSRIHNYSAVEMSKPLFGEHYVRVKSYCNDQ STGTLEIVSEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFIKRTPL WNGFKADFVGFSIPDHFVVGYSLDYNEIFRDLDHCCLVNDEGKKKYKATSL |
||||
| References | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Tang and Dr. Zhang.